Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XNG7

Protein Details
Accession A0A4Y9XNG7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-40TLWPGLVMPKKKPKRKTACRTRFTKERGHydrophilic
NLS Segment(s)
PositionSequence
21-29PKKKPKRKT
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MQPQCNKAPSRRTLWPGLVMPKKKPKRKTACRTRFTKERGAIRQLLTEQLRKISGDKNARMRWTAEDFHAHVAEQYGVCLEGWPRHLAFANLSDVPGGMSTMRDLHGRIERGTLAFTKLLNHKRGVLTVEDTAPGKFTPRAPRAERRDYGRQRIPPWQRLSRPPRRICMGPKSVEYIEDSDAHASDLEEIESVGEVAEDGAASEIESASGFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.6
3 0.55
4 0.58
5 0.6
6 0.56
7 0.59
8 0.63
9 0.69
10 0.72
11 0.76
12 0.78
13 0.8
14 0.87
15 0.9
16 0.9
17 0.91
18 0.91
19 0.89
20 0.86
21 0.85
22 0.79
23 0.78
24 0.74
25 0.72
26 0.7
27 0.69
28 0.66
29 0.57
30 0.55
31 0.46
32 0.46
33 0.4
34 0.36
35 0.31
36 0.28
37 0.28
38 0.24
39 0.26
40 0.24
41 0.29
42 0.34
43 0.38
44 0.45
45 0.49
46 0.5
47 0.49
48 0.46
49 0.43
50 0.4
51 0.36
52 0.28
53 0.28
54 0.27
55 0.28
56 0.26
57 0.21
58 0.16
59 0.15
60 0.14
61 0.1
62 0.08
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.13
76 0.12
77 0.13
78 0.12
79 0.12
80 0.1
81 0.1
82 0.09
83 0.08
84 0.06
85 0.03
86 0.03
87 0.04
88 0.05
89 0.06
90 0.06
91 0.07
92 0.09
93 0.13
94 0.14
95 0.14
96 0.15
97 0.14
98 0.14
99 0.15
100 0.13
101 0.1
102 0.1
103 0.1
104 0.12
105 0.18
106 0.24
107 0.25
108 0.26
109 0.27
110 0.27
111 0.28
112 0.27
113 0.22
114 0.18
115 0.17
116 0.16
117 0.14
118 0.14
119 0.13
120 0.12
121 0.1
122 0.1
123 0.11
124 0.15
125 0.24
126 0.28
127 0.35
128 0.4
129 0.5
130 0.56
131 0.63
132 0.63
133 0.6
134 0.67
135 0.67
136 0.7
137 0.68
138 0.65
139 0.6
140 0.66
141 0.68
142 0.65
143 0.66
144 0.65
145 0.63
146 0.68
147 0.75
148 0.76
149 0.78
150 0.75
151 0.73
152 0.71
153 0.71
154 0.68
155 0.68
156 0.65
157 0.58
158 0.54
159 0.53
160 0.48
161 0.43
162 0.38
163 0.3
164 0.24
165 0.22
166 0.21
167 0.16
168 0.16
169 0.15
170 0.13
171 0.1
172 0.1
173 0.09
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.06
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.03
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.06