FuNGI

A0A4Y9YNE3

Protein Details

Accession

A0A4Y9YNE3

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
79-102	ASLPTPPRTIKKRSRSRGSVFEDS	Hydrophilic
388-408	AKRPVRSLPPRAKAKGKSKSG	Basic

NLS Segment(s)

Position	Sequence
174-197	RRRIPGAEKVHPRPASARRVSASR
210-223	RHRPPVTPPRRRRV
386-407	KAAAKRPVRSLPPRAKAKGKSK

Subcellular Location(s)

nucl 13.5, mito 12, cyto_nucl 8

Family & Domain DBs

Amino Acid Sequences

MKKPAQTNPRVFIVLSSPPPSIFYPSHPVPTXHTFYRHASSTHPTSIMSTRAILDSSPIRAPPPTTTSTSNPLKRSASTASLPTPPRTIKKRSRSRGSVFEDSSDDDDHALPALSSDREDGPDPALKAENSSKRRKIDDLVAELSSEDREDAFWLGGASLSTAVAQPKSNTHQRRRIPGAEKVHPRPASARRVSASRTRPFSLLTPPTTRHRPPVTPPRRRRVSASTPSRRTSGKVAPVRDSPNNPFLADSPASLPSSPLEPRTPTHREEKPTLTYVFRGKKQEFMNPHFGVPRNPRSLLKPDHPDFSPSDNCTPRELFPHRARGPTHPAAVRGSTSRARLTSPDPWDSDDGGPGGSIPRITLAKEFEKAGVAAEFEDGEGEDEPKAAAKRPVRSLPPRAKAKGKSKSGLLDRILEAKEDEDDLSDAETVKAPTPRSKSRTRSAATKP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.34
3	0.33
4	0.29
5	0.28
6	0.31
7	0.3
8	0.31
9	0.26
10	0.27
11	0.32
12	0.34
13	0.42
14	0.41
15	0.43
16	0.42
17	0.46
18	0.49
19	0.44
20	0.46
21	0.41
22	0.46
23	0.45
24	0.41
25	0.39
26	0.39
27	0.41
28	0.4
29	0.38
30	0.31
31	0.32
32	0.34
33	0.33
34	0.27
35	0.22
36	0.2
37	0.2
38	0.2
39	0.16
40	0.17
41	0.17
42	0.19
43	0.19
44	0.19
45	0.19
46	0.2
47	0.23
48	0.24
49	0.27
50	0.27
51	0.29
52	0.34
53	0.36
54	0.43
55	0.5
56	0.52
57	0.49
58	0.5
59	0.48
60	0.44
61	0.45
62	0.41
63	0.37
64	0.33
65	0.35
66	0.33
67	0.37
68	0.39
69	0.37
70	0.38
71	0.37
72	0.43
73	0.46
74	0.53
75	0.56
76	0.64
77	0.73
78	0.77
79	0.83
80	0.84
81	0.84
82	0.84
83	0.82
84	0.79
85	0.69
86	0.61
87	0.52
88	0.45
89	0.4
90	0.31
91	0.23
92	0.16
93	0.15
94	0.13
95	0.11
96	0.09
97	0.07
98	0.06
99	0.08
100	0.07
101	0.08
102	0.09
103	0.1
104	0.12
105	0.13
106	0.14
107	0.15
108	0.18
109	0.18
110	0.18
111	0.19
112	0.17
113	0.19
114	0.26
115	0.32
116	0.36
117	0.44
118	0.49
119	0.51
120	0.55
121	0.55
122	0.51
123	0.51
124	0.51
125	0.47
126	0.44
127	0.39
128	0.36
129	0.32
130	0.29
131	0.2
132	0.13
133	0.08
134	0.05
135	0.05
136	0.06
137	0.07
138	0.06
139	0.06
140	0.06
141	0.06
142	0.06
143	0.06
144	0.05
145	0.04
146	0.04
147	0.04
148	0.05
149	0.07
150	0.07
151	0.08
152	0.09
153	0.12
154	0.18
155	0.27
156	0.35
157	0.42
158	0.51
159	0.55
160	0.63
161	0.66
162	0.69
163	0.65
164	0.64
165	0.63
166	0.62
167	0.65
168	0.6
169	0.62
170	0.54
171	0.5
172	0.48
173	0.47
174	0.48
175	0.43
176	0.42
177	0.36
178	0.38
179	0.4
180	0.42
181	0.43
182	0.39
183	0.41
184	0.39
185	0.38
186	0.37
187	0.36
188	0.36
189	0.32
190	0.3
191	0.29
192	0.3
193	0.34
194	0.38
195	0.38
196	0.37
197	0.37
198	0.36
199	0.41
200	0.5
201	0.56
202	0.61
203	0.68
204	0.71
205	0.72
206	0.71
207	0.68
208	0.65
209	0.64
210	0.64
211	0.66
212	0.66
213	0.65
214	0.65
215	0.61
216	0.54
217	0.46
218	0.41
219	0.36
220	0.36
221	0.36
222	0.37
223	0.38
224	0.41
225	0.44
226	0.41
227	0.39
228	0.34
229	0.33
230	0.32
231	0.29
232	0.25
233	0.22
234	0.23
235	0.19
236	0.16
237	0.13
238	0.14
239	0.15
240	0.14
241	0.13
242	0.09
243	0.12
244	0.12
245	0.13
246	0.13
247	0.15
248	0.16
249	0.24
250	0.27
251	0.27
252	0.34
253	0.37
254	0.4
255	0.43
256	0.46
257	0.43
258	0.43
259	0.42
260	0.35
261	0.32
262	0.35
263	0.36
264	0.36
265	0.39
266	0.36
267	0.41
268	0.43
269	0.47
270	0.47
271	0.47
272	0.51
273	0.45
274	0.46
275	0.42
276	0.41
277	0.41
278	0.41
279	0.43
280	0.38
281	0.39
282	0.4
283	0.41
284	0.48
285	0.47
286	0.47
287	0.48
288	0.46
289	0.48
290	0.46
291	0.45
292	0.39
293	0.39
294	0.37
295	0.31
296	0.36
297	0.36
298	0.37
299	0.37
300	0.37
301	0.32
302	0.36
303	0.37
304	0.39
305	0.41
306	0.5
307	0.49
308	0.52
309	0.53
310	0.52
311	0.56
312	0.51
313	0.51
314	0.42
315	0.41
316	0.38
317	0.37
318	0.33
319	0.25
320	0.26
321	0.24
322	0.25
323	0.26
324	0.24
325	0.24
326	0.26
327	0.29
328	0.33
329	0.35
330	0.36
331	0.35
332	0.37
333	0.38
334	0.37
335	0.33
336	0.26
337	0.21
338	0.16
339	0.15
340	0.12
341	0.11
342	0.08
343	0.08
344	0.06
345	0.09
346	0.1
347	0.11
348	0.14
349	0.18
350	0.21
351	0.23
352	0.24
353	0.22
354	0.23
355	0.22
356	0.2
357	0.15
358	0.12
359	0.11
360	0.1
361	0.09
362	0.07
363	0.08
364	0.06
365	0.07
366	0.07
367	0.08
368	0.07
369	0.07
370	0.08
371	0.11
372	0.12
373	0.14
374	0.21
375	0.27
376	0.34
377	0.42
378	0.5
379	0.55
380	0.63
381	0.7
382	0.73
383	0.76
384	0.79
385	0.77
386	0.78
387	0.79
388	0.8
389	0.8
390	0.78
391	0.73
392	0.69
393	0.72
394	0.7
395	0.68
396	0.6
397	0.55
398	0.48
399	0.5
400	0.45
401	0.37
402	0.3
403	0.24
404	0.22
405	0.19
406	0.17
407	0.12
408	0.13
409	0.12
410	0.12
411	0.12
412	0.11
413	0.11
414	0.13
415	0.13
416	0.17
417	0.21
418	0.23
419	0.31
420	0.38
421	0.47
422	0.51
423	0.6
424	0.64
425	0.7
426	0.77
427	0.74

A0A4Y9YNE3

3D AlphaFold-predicted Structure Viewer