Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YNE3

Protein Details
Accession A0A4Y9YNE3   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
79-102ASLPTPPRTIKKRSRSRGSVFEDSHydrophilic
388-408AKRPVRSLPPRAKAKGKSKSGBasic
NLS Segment(s)
PositionSequence
174-197RRRIPGAEKVHPRPASARRVSASR
210-223RHRPPVTPPRRRRV
386-407KAAAKRPVRSLPPRAKAKGKSK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MKKPAQTNPRVFIVLSSPPPSIFYPSHPVPTXHTFYRHASSTHPTSIMSTRAILDSSPIRAPPPTTTSTSNPLKRSASTASLPTPPRTIKKRSRSRGSVFEDSSDDDDHALPALSSDREDGPDPALKAENSSKRRKIDDLVAELSSEDREDAFWLGGASLSTAVAQPKSNTHQRRRIPGAEKVHPRPASARRVSASRTRPFSLLTPPTTRHRPPVTPPRRRRVSASTPSRRTSGKVAPVRDSPNNPFLADSPASLPSSPLEPRTPTHREEKPTLTYVFRGKKQEFMNPHFGVPRNPRSLLKPDHPDFSPSDNCTPRELFPHRARGPTHPAAVRGSTSRARLTSPDPWDSDDGGPGGSIPRITLAKEFEKAGVAAEFEDGEGEDEPKAAAKRPVRSLPPRAKAKGKSKSGLLDRILEAKEDEDDLSDAETVKAPTPRSKSRTRSAATKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.33
4 0.29
5 0.28
6 0.31
7 0.3
8 0.31
9 0.26
10 0.27
11 0.32
12 0.34
13 0.42
14 0.41
15 0.43
16 0.42
17 0.46
18 0.49
19 0.44
20 0.46
21 0.41
22 0.46
23 0.45
24 0.41
25 0.39
26 0.39
27 0.41
28 0.4
29 0.38
30 0.31
31 0.32
32 0.34
33 0.33
34 0.27
35 0.22
36 0.2
37 0.2
38 0.2
39 0.16
40 0.17
41 0.17
42 0.19
43 0.19
44 0.19
45 0.19
46 0.2
47 0.23
48 0.24
49 0.27
50 0.27
51 0.29
52 0.34
53 0.36
54 0.43
55 0.5
56 0.52
57 0.49
58 0.5
59 0.48
60 0.44
61 0.45
62 0.41
63 0.37
64 0.33
65 0.35
66 0.33
67 0.37
68 0.39
69 0.37
70 0.38
71 0.37
72 0.43
73 0.46
74 0.53
75 0.56
76 0.64
77 0.73
78 0.77
79 0.83
80 0.84
81 0.84
82 0.84
83 0.82
84 0.79
85 0.69
86 0.61
87 0.52
88 0.45
89 0.4
90 0.31
91 0.23
92 0.16
93 0.15
94 0.13
95 0.11
96 0.09
97 0.07
98 0.06
99 0.08
100 0.07
101 0.08
102 0.09
103 0.1
104 0.12
105 0.13
106 0.14
107 0.15
108 0.18
109 0.18
110 0.18
111 0.19
112 0.17
113 0.19
114 0.26
115 0.32
116 0.36
117 0.44
118 0.49
119 0.51
120 0.55
121 0.55
122 0.51
123 0.51
124 0.51
125 0.47
126 0.44
127 0.39
128 0.36
129 0.32
130 0.29
131 0.2
132 0.13
133 0.08
134 0.05
135 0.05
136 0.06
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.05
149 0.07
150 0.07
151 0.08
152 0.09
153 0.12
154 0.18
155 0.27
156 0.35
157 0.42
158 0.51
159 0.55
160 0.63
161 0.66
162 0.69
163 0.65
164 0.64
165 0.63
166 0.62
167 0.65
168 0.6
169 0.62
170 0.54
171 0.5
172 0.48
173 0.47
174 0.48
175 0.43
176 0.42
177 0.36
178 0.38
179 0.4
180 0.42
181 0.43
182 0.39
183 0.41
184 0.39
185 0.38
186 0.37
187 0.36
188 0.36
189 0.32
190 0.3
191 0.29
192 0.3
193 0.34
194 0.38
195 0.38
196 0.37
197 0.37
198 0.36
199 0.41
200 0.5
201 0.56
202 0.61
203 0.68
204 0.71
205 0.72
206 0.71
207 0.68
208 0.65
209 0.64
210 0.64
211 0.66
212 0.66
213 0.65
214 0.65
215 0.61
216 0.54
217 0.46
218 0.41
219 0.36
220 0.36
221 0.36
222 0.37
223 0.38
224 0.41
225 0.44
226 0.41
227 0.39
228 0.34
229 0.33
230 0.32
231 0.29
232 0.25
233 0.22
234 0.23
235 0.19
236 0.16
237 0.13
238 0.14
239 0.15
240 0.14
241 0.13
242 0.09
243 0.12
244 0.12
245 0.13
246 0.13
247 0.15
248 0.16
249 0.24
250 0.27
251 0.27
252 0.34
253 0.37
254 0.4
255 0.43
256 0.46
257 0.43
258 0.43
259 0.42
260 0.35
261 0.32
262 0.35
263 0.36
264 0.36
265 0.39
266 0.36
267 0.41
268 0.43
269 0.47
270 0.47
271 0.47
272 0.51
273 0.45
274 0.46
275 0.42
276 0.41
277 0.41
278 0.41
279 0.43
280 0.38
281 0.39
282 0.4
283 0.41
284 0.48
285 0.47
286 0.47
287 0.48
288 0.46
289 0.48
290 0.46
291 0.45
292 0.39
293 0.39
294 0.37
295 0.31
296 0.36
297 0.36
298 0.37
299 0.37
300 0.37
301 0.32
302 0.36
303 0.37
304 0.39
305 0.41
306 0.5
307 0.49
308 0.52
309 0.53
310 0.52
311 0.56
312 0.51
313 0.51
314 0.42
315 0.41
316 0.38
317 0.37
318 0.33
319 0.25
320 0.26
321 0.24
322 0.25
323 0.26
324 0.24
325 0.24
326 0.26
327 0.29
328 0.33
329 0.35
330 0.36
331 0.35
332 0.37
333 0.38
334 0.37
335 0.33
336 0.26
337 0.21
338 0.16
339 0.15
340 0.12
341 0.11
342 0.08
343 0.08
344 0.06
345 0.09
346 0.1
347 0.11
348 0.14
349 0.18
350 0.21
351 0.23
352 0.24
353 0.22
354 0.23
355 0.22
356 0.2
357 0.15
358 0.12
359 0.11
360 0.1
361 0.09
362 0.07
363 0.08
364 0.06
365 0.07
366 0.07
367 0.08
368 0.07
369 0.07
370 0.08
371 0.11
372 0.12
373 0.14
374 0.21
375 0.27
376 0.34
377 0.42
378 0.5
379 0.55
380 0.63
381 0.7
382 0.73
383 0.76
384 0.79
385 0.77
386 0.78
387 0.79
388 0.8
389 0.8
390 0.78
391 0.73
392 0.69
393 0.72
394 0.7
395 0.68
396 0.6
397 0.55
398 0.48
399 0.5
400 0.45
401 0.37
402 0.3
403 0.24
404 0.22
405 0.19
406 0.17
407 0.12
408 0.13
409 0.12
410 0.12
411 0.12
412 0.11
413 0.11
414 0.13
415 0.13
416 0.17
417 0.21
418 0.23
419 0.31
420 0.38
421 0.47
422 0.51
423 0.6
424 0.64
425 0.7
426 0.77
427 0.74