Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9XWE7

Protein Details
Accession A0A4Y9XWE7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-34DDEHPHRRNKGKGKAIDRSQKGKBasic
NLS Segment(s)
PositionSequence
17-38HRRNKGKGKAIDRSQKGKGKAK
Subcellular Location(s) nucl 12, cyto_nucl 12, cyto 10, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007198  Ssl1-like  
IPR002035  VWF_A  
IPR036465  vWFA_dom_sf  
Pfam View protein in Pfam  
PF04056  Ssl1  
PROSITE View protein in PROSITE  
PS50234  VWFA  
Amino Acid Sequences MDPEYDSDVSIDDEHPHRRNKGKGKAIDRSQKGKGKAKEQPYAWEASYTRSWDTVQEDEGGSITGAVQDFMARGRRRRLLAPAAAIRRTIIRHLILLLDLSAAMYDRDMRPTRFDLTLEYAREFIVEWFDQNPLGQIGVVGMRGGIGERIGEMSGNPQDVLKALSERHKLEPVGEPSLQNAIEMARSSMSHLPTHSSREILIIFGSLTTVDPGNIDDTLQACVKDRIRISIVALAAEMKICRELCDKTGGTPPLPPPLPHPHLASLTHCNXMYATGQFGVAMNEGHFKDLLFELIPPPRTTRLPRRGSGGPDAHGLPDAAAGHVAAEPVRVPRGDAQRRLPVPAVRREGVRRADGLRRVRAHDRELAASRAQLSPFVPRQALCRCVRVPLSPPSGPGTRVPCVPALVQDAAGGGRGRGRDGGRDEPVGEVSLSGVQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.4
4 0.46
5 0.52
6 0.61
7 0.67
8 0.72
9 0.74
10 0.77
11 0.8
12 0.83
13 0.85
14 0.85
15 0.82
16 0.79
17 0.78
18 0.76
19 0.75
20 0.75
21 0.72
22 0.71
23 0.73
24 0.74
25 0.74
26 0.68
27 0.68
28 0.61
29 0.59
30 0.49
31 0.46
32 0.37
33 0.34
34 0.36
35 0.31
36 0.29
37 0.26
38 0.26
39 0.25
40 0.28
41 0.26
42 0.23
43 0.23
44 0.22
45 0.2
46 0.2
47 0.16
48 0.12
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.1
58 0.18
59 0.21
60 0.26
61 0.34
62 0.4
63 0.43
64 0.47
65 0.53
66 0.53
67 0.54
68 0.55
69 0.56
70 0.55
71 0.52
72 0.48
73 0.4
74 0.35
75 0.31
76 0.27
77 0.24
78 0.2
79 0.2
80 0.21
81 0.21
82 0.18
83 0.16
84 0.13
85 0.09
86 0.07
87 0.06
88 0.05
89 0.05
90 0.04
91 0.04
92 0.07
93 0.08
94 0.15
95 0.19
96 0.2
97 0.25
98 0.28
99 0.31
100 0.29
101 0.29
102 0.25
103 0.29
104 0.33
105 0.3
106 0.28
107 0.25
108 0.23
109 0.22
110 0.19
111 0.13
112 0.12
113 0.11
114 0.11
115 0.11
116 0.12
117 0.12
118 0.12
119 0.12
120 0.08
121 0.08
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.04
136 0.05
137 0.05
138 0.05
139 0.04
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.1
148 0.08
149 0.08
150 0.1
151 0.16
152 0.21
153 0.24
154 0.26
155 0.28
156 0.27
157 0.28
158 0.33
159 0.3
160 0.3
161 0.28
162 0.26
163 0.23
164 0.25
165 0.23
166 0.16
167 0.12
168 0.08
169 0.08
170 0.08
171 0.08
172 0.06
173 0.06
174 0.09
175 0.12
176 0.13
177 0.13
178 0.14
179 0.17
180 0.18
181 0.23
182 0.21
183 0.18
184 0.16
185 0.17
186 0.17
187 0.13
188 0.12
189 0.07
190 0.06
191 0.06
192 0.05
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.08
206 0.08
207 0.08
208 0.08
209 0.12
210 0.13
211 0.16
212 0.16
213 0.17
214 0.18
215 0.19
216 0.19
217 0.19
218 0.18
219 0.14
220 0.13
221 0.11
222 0.09
223 0.09
224 0.08
225 0.04
226 0.06
227 0.06
228 0.08
229 0.1
230 0.12
231 0.13
232 0.19
233 0.19
234 0.19
235 0.25
236 0.25
237 0.23
238 0.26
239 0.25
240 0.25
241 0.26
242 0.24
243 0.24
244 0.31
245 0.34
246 0.33
247 0.34
248 0.3
249 0.32
250 0.33
251 0.3
252 0.27
253 0.26
254 0.24
255 0.22
256 0.19
257 0.17
258 0.17
259 0.15
260 0.11
261 0.09
262 0.08
263 0.09
264 0.09
265 0.09
266 0.08
267 0.08
268 0.06
269 0.1
270 0.1
271 0.1
272 0.1
273 0.09
274 0.1
275 0.1
276 0.11
277 0.07
278 0.08
279 0.1
280 0.15
281 0.17
282 0.16
283 0.18
284 0.2
285 0.24
286 0.31
287 0.39
288 0.45
289 0.5
290 0.51
291 0.54
292 0.56
293 0.56
294 0.57
295 0.49
296 0.4
297 0.36
298 0.35
299 0.29
300 0.25
301 0.21
302 0.12
303 0.11
304 0.1
305 0.07
306 0.07
307 0.06
308 0.06
309 0.06
310 0.07
311 0.05
312 0.05
313 0.06
314 0.07
315 0.09
316 0.09
317 0.1
318 0.17
319 0.28
320 0.35
321 0.41
322 0.45
323 0.53
324 0.54
325 0.56
326 0.53
327 0.48
328 0.46
329 0.49
330 0.5
331 0.42
332 0.45
333 0.46
334 0.5
335 0.5
336 0.46
337 0.4
338 0.38
339 0.44
340 0.48
341 0.5
342 0.51
343 0.5
344 0.53
345 0.58
346 0.58
347 0.55
348 0.54
349 0.5
350 0.48
351 0.47
352 0.45
353 0.38
354 0.34
355 0.32
356 0.27
357 0.25
358 0.21
359 0.19
360 0.24
361 0.27
362 0.29
363 0.28
364 0.26
365 0.32
366 0.37
367 0.44
368 0.39
369 0.42
370 0.39
371 0.43
372 0.46
373 0.44
374 0.44
375 0.44
376 0.49
377 0.42
378 0.44
379 0.43
380 0.42
381 0.4
382 0.4
383 0.37
384 0.32
385 0.33
386 0.33
387 0.3
388 0.3
389 0.29
390 0.26
391 0.25
392 0.24
393 0.22
394 0.19
395 0.18
396 0.16
397 0.18
398 0.15
399 0.1
400 0.12
401 0.12
402 0.14
403 0.19
404 0.2
405 0.25
406 0.31
407 0.38
408 0.39
409 0.41
410 0.4
411 0.36
412 0.36
413 0.3
414 0.24
415 0.16
416 0.13