Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9XSY8

Protein Details
Accession A0A4Y9XSY8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-121FKIPKIPKIPKAPKAPKTPKAPKTPKAPKTTPPKTTPPKTSHydrophilic
NLS Segment(s)
PositionSequence
84-116PKIPKIPKAPKAPKTPKAPKTPKAPKTTPPKTT
Subcellular Location(s) extr 14, mito 6, E.R. 3, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MRSYAAVVALAVVASGAPAFAGPVISERDMEVVERSHNSAALARRLSNIRDAVLLARDDAAPASAEPAAAGEGATQGNEFFKIPKIPKIPKAPKAPKTPKAPKTPKAPKTTPPKTTPPKTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.06
11 0.09
12 0.09
13 0.1
14 0.1
15 0.11
16 0.11
17 0.12
18 0.11
19 0.09
20 0.11
21 0.11
22 0.13
23 0.12
24 0.13
25 0.12
26 0.15
27 0.17
28 0.2
29 0.2
30 0.19
31 0.21
32 0.23
33 0.23
34 0.23
35 0.21
36 0.17
37 0.16
38 0.16
39 0.14
40 0.14
41 0.13
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.05
49 0.04
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.08
69 0.14
70 0.16
71 0.23
72 0.31
73 0.36
74 0.44
75 0.54
76 0.61
77 0.64
78 0.73
79 0.76
80 0.76
81 0.82
82 0.84
83 0.81
84 0.83
85 0.85
86 0.82
87 0.84
88 0.85
89 0.81
90 0.83
91 0.85
92 0.83
93 0.82
94 0.79
95 0.76
96 0.78
97 0.8
98 0.78
99 0.74
100 0.75
101 0.76
102 0.8