Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZDQ1

Protein Details
Accession A0A4Y9ZDQ1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
352-371EWWLRRSKPKTNTAPHDPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 9.5, cyto 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027539  Mdm10  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0000002  P:mitochondrial genome maintenance  
GO:0070096  P:mitochondrial outer membrane translocase complex assembly  
GO:1990456  P:mitochondrion-endoplasmic reticulum membrane tethering  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
Pfam View protein in Pfam  
PF12519  MDM10  
Amino Acid Sequences MHPFATYVLRSYYKATGWNEDSLYTNLTRSSNAILDFSVPRGLHLSVSKSPNALFRTTYSMNALPSLNGSVGYIFSSCDLDVKGSADVRFKDMIDRFRVYDQPRRPEGKEEAWLFGERVDTRDYLLYGRLYVPTGRLDALYSTRISPTLQAVVAAISDPRSDIMHSRTTRTGASPSNLMLSLQQDTGRWCTEYTYSAEDSMFGVRTLHNFGKLSTPCDVDESERSGXRSKVKRIDEEDAMEGGLKGRISAGAEVYFSAKEKSGGLSTGIRFTTLPDATPPSFQLPPESPTSPAQSTPQFLPTQPPTTITALFNPMLGHISGAYAARASRDLSLCSRFDFNVYSYESEWTVGAEWWLRRSKPKTNTAPHDPSPEGTSSLMDTPSPPIDVAGVVKARASTSNEVALMWEGRLQNVLVSLGVSANLSRSTKPIKSLGLELSYFSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.39
5 0.42
6 0.39
7 0.36
8 0.37
9 0.32
10 0.31
11 0.24
12 0.21
13 0.2
14 0.2
15 0.2
16 0.18
17 0.2
18 0.2
19 0.2
20 0.2
21 0.18
22 0.2
23 0.21
24 0.2
25 0.22
26 0.19
27 0.19
28 0.21
29 0.21
30 0.21
31 0.23
32 0.27
33 0.28
34 0.33
35 0.33
36 0.32
37 0.32
38 0.36
39 0.36
40 0.32
41 0.27
42 0.25
43 0.32
44 0.32
45 0.32
46 0.3
47 0.29
48 0.28
49 0.28
50 0.26
51 0.18
52 0.18
53 0.18
54 0.13
55 0.11
56 0.11
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.08
63 0.09
64 0.08
65 0.09
66 0.1
67 0.1
68 0.11
69 0.12
70 0.13
71 0.14
72 0.16
73 0.2
74 0.2
75 0.23
76 0.23
77 0.22
78 0.28
79 0.3
80 0.34
81 0.35
82 0.37
83 0.35
84 0.37
85 0.44
86 0.41
87 0.46
88 0.48
89 0.51
90 0.56
91 0.59
92 0.58
93 0.58
94 0.59
95 0.55
96 0.55
97 0.48
98 0.43
99 0.4
100 0.39
101 0.32
102 0.26
103 0.25
104 0.17
105 0.17
106 0.16
107 0.14
108 0.15
109 0.16
110 0.16
111 0.13
112 0.15
113 0.13
114 0.12
115 0.13
116 0.13
117 0.13
118 0.13
119 0.13
120 0.12
121 0.13
122 0.12
123 0.11
124 0.11
125 0.12
126 0.13
127 0.13
128 0.13
129 0.13
130 0.13
131 0.13
132 0.13
133 0.13
134 0.13
135 0.13
136 0.12
137 0.11
138 0.11
139 0.1
140 0.1
141 0.08
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.07
149 0.09
150 0.13
151 0.21
152 0.22
153 0.25
154 0.26
155 0.27
156 0.27
157 0.26
158 0.27
159 0.21
160 0.22
161 0.19
162 0.18
163 0.18
164 0.17
165 0.15
166 0.12
167 0.11
168 0.11
169 0.1
170 0.1
171 0.1
172 0.11
173 0.14
174 0.13
175 0.13
176 0.11
177 0.12
178 0.13
179 0.14
180 0.15
181 0.15
182 0.15
183 0.15
184 0.15
185 0.14
186 0.13
187 0.12
188 0.1
189 0.07
190 0.07
191 0.07
192 0.08
193 0.12
194 0.12
195 0.13
196 0.13
197 0.14
198 0.2
199 0.21
200 0.22
201 0.19
202 0.2
203 0.18
204 0.19
205 0.19
206 0.14
207 0.15
208 0.17
209 0.17
210 0.18
211 0.18
212 0.18
213 0.23
214 0.25
215 0.32
216 0.34
217 0.4
218 0.44
219 0.47
220 0.5
221 0.46
222 0.44
223 0.37
224 0.3
225 0.23
226 0.17
227 0.13
228 0.09
229 0.08
230 0.06
231 0.05
232 0.05
233 0.05
234 0.06
235 0.07
236 0.07
237 0.06
238 0.07
239 0.07
240 0.08
241 0.08
242 0.08
243 0.08
244 0.07
245 0.08
246 0.08
247 0.09
248 0.09
249 0.09
250 0.11
251 0.14
252 0.14
253 0.17
254 0.16
255 0.15
256 0.14
257 0.15
258 0.19
259 0.16
260 0.15
261 0.14
262 0.18
263 0.18
264 0.19
265 0.19
266 0.17
267 0.18
268 0.18
269 0.2
270 0.18
271 0.2
272 0.23
273 0.23
274 0.22
275 0.23
276 0.28
277 0.25
278 0.24
279 0.25
280 0.22
281 0.24
282 0.23
283 0.25
284 0.21
285 0.21
286 0.26
287 0.27
288 0.29
289 0.26
290 0.27
291 0.26
292 0.28
293 0.3
294 0.24
295 0.22
296 0.22
297 0.21
298 0.2
299 0.16
300 0.14
301 0.13
302 0.12
303 0.1
304 0.07
305 0.07
306 0.07
307 0.07
308 0.07
309 0.06
310 0.06
311 0.07
312 0.08
313 0.09
314 0.11
315 0.12
316 0.15
317 0.18
318 0.23
319 0.23
320 0.24
321 0.25
322 0.22
323 0.22
324 0.22
325 0.19
326 0.19
327 0.21
328 0.21
329 0.19
330 0.21
331 0.19
332 0.18
333 0.17
334 0.12
335 0.11
336 0.1
337 0.1
338 0.12
339 0.13
340 0.18
341 0.24
342 0.25
343 0.33
344 0.39
345 0.47
346 0.53
347 0.62
348 0.67
349 0.71
350 0.78
351 0.79
352 0.81
353 0.75
354 0.72
355 0.63
356 0.54
357 0.48
358 0.41
359 0.33
360 0.25
361 0.22
362 0.17
363 0.18
364 0.17
365 0.14
366 0.14
367 0.15
368 0.16
369 0.16
370 0.14
371 0.12
372 0.12
373 0.13
374 0.13
375 0.14
376 0.14
377 0.13
378 0.14
379 0.15
380 0.15
381 0.18
382 0.22
383 0.21
384 0.23
385 0.27
386 0.26
387 0.25
388 0.25
389 0.24
390 0.2
391 0.15
392 0.17
393 0.14
394 0.14
395 0.16
396 0.15
397 0.13
398 0.13
399 0.14
400 0.09
401 0.09
402 0.09
403 0.08
404 0.08
405 0.08
406 0.07
407 0.08
408 0.12
409 0.14
410 0.14
411 0.19
412 0.27
413 0.29
414 0.34
415 0.38
416 0.4
417 0.41
418 0.46
419 0.46
420 0.43
421 0.4
422 0.37