Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XZ21

Protein Details
Accession A0A4Y9XZ21   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-196ASGQHRTRRAQRARKKNKGAKARRPKRVFDBasic
NLS Segment(s)
PositionSequence
149-194RRTRTHAPAPRHPTPAPAASGQHRTRRAQRAXRKKNKGAKARRPKR
Subcellular Location(s) mito 13, nucl 8, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MASSNSRSSTYRDLTPCLLGTLIPHQYHISAIANCRSQPPPNPTHELPRRYARASAGDRHPAARLGRGPDRDAYSSRESTEDRGPKKVVALERLRGRGEHYPICSRSYPRCMRFESRDRIRIQWQRTRRHWRAQYAAAAEANARPRCARRTRTHAPAPRHPTPAPAASGQHRTRRAQRAXRKKNKGAKARRPKRVFDYGITCCQACFLFSPAGWQPHNYYGHRRCQGRNCRFTIARGMPLFSFGPSAPPNFDIVGLGVRSTMMYIYMYHECRRFHASQRVPISEQGHAGLQAPRVIRTTTLVLSNAQRTMHNAHRDIPTSRSTVIMTEKDEEEKSETIKYATRKLMDPHPQAPDRHQTPGIPRRRFQLARIPVLRARF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.41
4 0.33
5 0.29
6 0.21
7 0.2
8 0.22
9 0.26
10 0.24
11 0.24
12 0.24
13 0.24
14 0.25
15 0.25
16 0.23
17 0.19
18 0.23
19 0.28
20 0.29
21 0.3
22 0.34
23 0.35
24 0.35
25 0.4
26 0.45
27 0.47
28 0.51
29 0.58
30 0.56
31 0.63
32 0.67
33 0.64
34 0.62
35 0.63
36 0.62
37 0.56
38 0.57
39 0.5
40 0.5
41 0.5
42 0.52
43 0.49
44 0.52
45 0.5
46 0.48
47 0.46
48 0.41
49 0.37
50 0.35
51 0.33
52 0.31
53 0.37
54 0.39
55 0.4
56 0.4
57 0.43
58 0.4
59 0.38
60 0.37
61 0.36
62 0.35
63 0.33
64 0.33
65 0.29
66 0.3
67 0.37
68 0.39
69 0.36
70 0.4
71 0.4
72 0.37
73 0.39
74 0.41
75 0.36
76 0.36
77 0.39
78 0.41
79 0.46
80 0.48
81 0.46
82 0.41
83 0.41
84 0.39
85 0.39
86 0.37
87 0.35
88 0.39
89 0.4
90 0.43
91 0.42
92 0.4
93 0.41
94 0.46
95 0.51
96 0.49
97 0.53
98 0.55
99 0.58
100 0.63
101 0.66
102 0.66
103 0.65
104 0.67
105 0.63
106 0.62
107 0.64
108 0.63
109 0.61
110 0.6
111 0.61
112 0.63
113 0.71
114 0.78
115 0.75
116 0.78
117 0.77
118 0.76
119 0.73
120 0.68
121 0.64
122 0.55
123 0.5
124 0.39
125 0.32
126 0.25
127 0.21
128 0.23
129 0.19
130 0.17
131 0.17
132 0.2
133 0.27
134 0.35
135 0.41
136 0.41
137 0.5
138 0.57
139 0.64
140 0.71
141 0.7
142 0.69
143 0.7
144 0.71
145 0.67
146 0.65
147 0.56
148 0.5
149 0.45
150 0.41
151 0.33
152 0.27
153 0.24
154 0.22
155 0.3
156 0.31
157 0.34
158 0.36
159 0.37
160 0.44
161 0.52
162 0.59
163 0.61
164 0.67
165 0.72
166 0.79
167 0.86
168 0.88
169 0.85
170 0.84
171 0.84
172 0.85
173 0.84
174 0.85
175 0.84
176 0.84
177 0.81
178 0.77
179 0.72
180 0.71
181 0.63
182 0.55
183 0.52
184 0.45
185 0.44
186 0.41
187 0.34
188 0.25
189 0.23
190 0.19
191 0.13
192 0.1
193 0.09
194 0.09
195 0.09
196 0.13
197 0.14
198 0.18
199 0.18
200 0.18
201 0.18
202 0.23
203 0.28
204 0.26
205 0.33
206 0.35
207 0.44
208 0.49
209 0.5
210 0.49
211 0.55
212 0.65
213 0.65
214 0.67
215 0.62
216 0.63
217 0.6
218 0.56
219 0.55
220 0.46
221 0.42
222 0.35
223 0.33
224 0.26
225 0.28
226 0.26
227 0.17
228 0.16
229 0.1
230 0.14
231 0.14
232 0.15
233 0.14
234 0.14
235 0.15
236 0.14
237 0.14
238 0.1
239 0.1
240 0.11
241 0.09
242 0.08
243 0.07
244 0.06
245 0.06
246 0.06
247 0.05
248 0.04
249 0.05
250 0.05
251 0.09
252 0.14
253 0.17
254 0.2
255 0.24
256 0.24
257 0.26
258 0.33
259 0.32
260 0.35
261 0.43
262 0.47
263 0.51
264 0.57
265 0.58
266 0.53
267 0.54
268 0.49
269 0.4
270 0.35
271 0.27
272 0.22
273 0.18
274 0.19
275 0.16
276 0.15
277 0.17
278 0.16
279 0.17
280 0.18
281 0.18
282 0.17
283 0.17
284 0.19
285 0.17
286 0.19
287 0.19
288 0.19
289 0.23
290 0.25
291 0.24
292 0.22
293 0.21
294 0.22
295 0.27
296 0.32
297 0.36
298 0.35
299 0.38
300 0.41
301 0.45
302 0.44
303 0.41
304 0.37
305 0.33
306 0.32
307 0.28
308 0.24
309 0.24
310 0.27
311 0.26
312 0.25
313 0.26
314 0.27
315 0.29
316 0.29
317 0.28
318 0.26
319 0.24
320 0.23
321 0.23
322 0.22
323 0.21
324 0.26
325 0.28
326 0.31
327 0.36
328 0.37
329 0.39
330 0.42
331 0.5
332 0.56
333 0.58
334 0.57
335 0.59
336 0.61
337 0.6
338 0.62
339 0.62
340 0.55
341 0.54
342 0.51
343 0.46
344 0.52
345 0.59
346 0.63
347 0.6
348 0.58
349 0.58
350 0.65
351 0.63
352 0.58
353 0.59
354 0.58
355 0.61
356 0.63
357 0.63