Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZBU4

Protein Details
Accession A0A4Y9ZBU4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28YSKGRVLGHKRGKRNTHPNTSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRGKRNTHPNTSLLQIEGVGSKEDAQFYLGKRVAYVYRAKKEIHGSKVRVIWGRVTRSHGSGGVVKSKFRSNLPPHAFGATVRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.75
5 0.79
6 0.8
7 0.84
8 0.82
9 0.82
10 0.78
11 0.71
12 0.64
13 0.58
14 0.48
15 0.38
16 0.28
17 0.18
18 0.14
19 0.12
20 0.11
21 0.08
22 0.07
23 0.08
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.25
39 0.27
40 0.3
41 0.3
42 0.31
43 0.39
44 0.42
45 0.42
46 0.43
47 0.41
48 0.43
49 0.46
50 0.46
51 0.4
52 0.35
53 0.33
54 0.32
55 0.34
56 0.32
57 0.36
58 0.34
59 0.33
60 0.34
61 0.28
62 0.24
63 0.25
64 0.25
65 0.27
66 0.26
67 0.25
68 0.26
69 0.3
70 0.31
71 0.29
72 0.37
73 0.36
74 0.46
75 0.51
76 0.53
77 0.5
78 0.49
79 0.47
80 0.37
81 0.35
82 0.25
83 0.2
84 0.16
85 0.15
86 0.13