Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Z8S6

Protein Details
Accession A0A4Y9Z8S6   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-54EVNDLKARIREKRRRLPGSWHydrophilic
NLS Segment(s)
PositionSequence
42-50RIREKRRRL
Subcellular Location(s) extr 12, mito 5, cyto 3.5, cyto_nucl 3.5, nucl 2.5, plas 2
Family & Domain DBs
Amino Acid Sequences MAPRSSPILDFGTFFSPANPELDVRRSVAPLTSTEVNDLKARIREKRRRLPGSWISGIARRPSSIRDTTHDRAVTHIATPYSVAHSRGPQDRTIGTHEPSIRPSVKDSPFLIPHPDLFSTRVHHISAAPALHLLIMVLSLLQFQPPQQQTPSSNLPQQKRGFFPCVMYSTXSGAQSGFRHADATSRSIANAFANGNLTRVEVRIDNIRAAARIRLVQLLLPHLDEERPHRLHAPHGRHGRGVVALIAQVDAERRLHANAPLHGVAGMLAEVEGGRGAVDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.17
5 0.18
6 0.16
7 0.15
8 0.17
9 0.21
10 0.22
11 0.22
12 0.24
13 0.23
14 0.23
15 0.24
16 0.21
17 0.19
18 0.22
19 0.23
20 0.22
21 0.25
22 0.25
23 0.24
24 0.25
25 0.24
26 0.23
27 0.25
28 0.3
29 0.36
30 0.46
31 0.54
32 0.63
33 0.72
34 0.78
35 0.8
36 0.79
37 0.8
38 0.78
39 0.76
40 0.68
41 0.6
42 0.51
43 0.47
44 0.47
45 0.41
46 0.33
47 0.26
48 0.25
49 0.25
50 0.3
51 0.31
52 0.31
53 0.32
54 0.4
55 0.42
56 0.48
57 0.46
58 0.4
59 0.37
60 0.37
61 0.32
62 0.25
63 0.24
64 0.17
65 0.15
66 0.16
67 0.14
68 0.15
69 0.16
70 0.17
71 0.16
72 0.19
73 0.23
74 0.29
75 0.3
76 0.27
77 0.28
78 0.27
79 0.28
80 0.32
81 0.3
82 0.25
83 0.28
84 0.29
85 0.27
86 0.28
87 0.3
88 0.26
89 0.23
90 0.26
91 0.3
92 0.3
93 0.32
94 0.33
95 0.32
96 0.33
97 0.33
98 0.33
99 0.25
100 0.24
101 0.22
102 0.21
103 0.17
104 0.17
105 0.17
106 0.16
107 0.18
108 0.19
109 0.17
110 0.16
111 0.15
112 0.15
113 0.15
114 0.13
115 0.1
116 0.08
117 0.08
118 0.07
119 0.07
120 0.05
121 0.03
122 0.02
123 0.02
124 0.02
125 0.02
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.11
132 0.12
133 0.14
134 0.15
135 0.18
136 0.19
137 0.24
138 0.29
139 0.24
140 0.28
141 0.33
142 0.35
143 0.4
144 0.42
145 0.4
146 0.38
147 0.4
148 0.4
149 0.34
150 0.34
151 0.29
152 0.27
153 0.25
154 0.23
155 0.2
156 0.18
157 0.18
158 0.17
159 0.14
160 0.13
161 0.12
162 0.15
163 0.15
164 0.13
165 0.13
166 0.12
167 0.15
168 0.16
169 0.18
170 0.16
171 0.15
172 0.15
173 0.14
174 0.15
175 0.12
176 0.12
177 0.1
178 0.09
179 0.12
180 0.11
181 0.12
182 0.11
183 0.12
184 0.1
185 0.1
186 0.11
187 0.09
188 0.11
189 0.16
190 0.17
191 0.17
192 0.18
193 0.19
194 0.18
195 0.19
196 0.19
197 0.14
198 0.15
199 0.15
200 0.15
201 0.15
202 0.15
203 0.16
204 0.17
205 0.16
206 0.15
207 0.14
208 0.13
209 0.14
210 0.14
211 0.18
212 0.24
213 0.25
214 0.26
215 0.3
216 0.31
217 0.39
218 0.47
219 0.5
220 0.51
221 0.58
222 0.58
223 0.55
224 0.54
225 0.47
226 0.38
227 0.31
228 0.23
229 0.15
230 0.13
231 0.12
232 0.11
233 0.09
234 0.08
235 0.08
236 0.09
237 0.09
238 0.1
239 0.11
240 0.13
241 0.16
242 0.22
243 0.26
244 0.27
245 0.32
246 0.31
247 0.3
248 0.28
249 0.25
250 0.2
251 0.14
252 0.11
253 0.05
254 0.05
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04