Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZEN2

Protein Details
Accession A0A4Y9ZEN2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
76-116EYQPSQRVRKRRHGFLARKRSVGGRKILARRKAKQRRFLTHBasic
NLS Segment(s)
PositionSequence
82-112RVRKRRHGFLARKRSVGGRKILARRKAKQRR
Subcellular Location(s) mito 19, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPLHLLRLVRPLPAQCPRFTPQRPVVQSALSPSFPAFLGRSLFLTRSLLPAAPDAHPFAPSMLQVRHRSRGNEYQPSQRVRKRRHGFLARKRSVGGRKILARRKAKQRRFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.4
4 0.4
5 0.35
6 0.4
7 0.41
8 0.47
9 0.48
10 0.49
11 0.48
12 0.55
13 0.57
14 0.56
15 0.54
16 0.46
17 0.43
18 0.39
19 0.34
20 0.24
21 0.22
22 0.17
23 0.16
24 0.14
25 0.15
26 0.11
27 0.1
28 0.11
29 0.11
30 0.13
31 0.13
32 0.13
33 0.12
34 0.14
35 0.12
36 0.12
37 0.12
38 0.11
39 0.11
40 0.12
41 0.13
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.1
49 0.09
50 0.08
51 0.1
52 0.11
53 0.17
54 0.23
55 0.26
56 0.32
57 0.34
58 0.36
59 0.4
60 0.47
61 0.49
62 0.51
63 0.51
64 0.54
65 0.58
66 0.61
67 0.62
68 0.59
69 0.61
70 0.59
71 0.68
72 0.66
73 0.69
74 0.74
75 0.77
76 0.82
77 0.84
78 0.87
79 0.8
80 0.74
81 0.67
82 0.64
83 0.61
84 0.57
85 0.53
86 0.49
87 0.53
88 0.61
89 0.68
90 0.7
91 0.71
92 0.74
93 0.79
94 0.83
95 0.84
96 0.84