Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YS47

Protein Details
Accession A0A4Y9YS47   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPAHHRHHRHDQHDPVPSHBasic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 9.5, nucl 6, mito 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001805  Adenokinase  
IPR011611  PfkB_dom  
IPR029056  Ribokinase-like  
Gene Ontology GO:0004001  F:adenosine kinase activity  
GO:0005524  F:ATP binding  
GO:0044209  P:AMP salvage  
GO:0016310  P:phosphorylation  
GO:0006166  P:purine ribonucleoside salvage  
Pfam View protein in Pfam  
PF00294  PfkB  
Amino Acid Sequences MPPAHHRHHRHDQHDPVPSHSPSPPIHPCHLQSIPYVGDDELAEQLKVANRREGLAEAYLVKKGEKTGTCAVVIMGHGCLLITDLRAAENFEQAHFAMPAVARLIDAAKFYYIEGYFLTYGGATSSRTASSLPLRLPRRRLRLPSGAMPIFALNLSMPFIPQFFEAQASAVGLPVDSSIPTIASGADVTVIVPGAGMELQVFAVRALASKQIVDMNSAGDAFAGGFMGALVVGKTLAEQLGASCDTHIAPTPLLRCPTPICTASPLQRFHAPPALLPHLVVPVCACTITPPLHCQTVPGIGTLAPIRALCAIVPIPRCPCPCAIVRSLWHPSAVLPAAPPPLCPASALYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.73
3 0.67
4 0.64
5 0.58
6 0.52
7 0.44
8 0.43
9 0.35
10 0.42
11 0.44
12 0.43
13 0.47
14 0.49
15 0.49
16 0.51
17 0.53
18 0.46
19 0.39
20 0.38
21 0.33
22 0.28
23 0.27
24 0.19
25 0.17
26 0.15
27 0.15
28 0.14
29 0.13
30 0.12
31 0.11
32 0.13
33 0.17
34 0.22
35 0.23
36 0.25
37 0.25
38 0.27
39 0.28
40 0.28
41 0.26
42 0.21
43 0.21
44 0.17
45 0.18
46 0.19
47 0.17
48 0.16
49 0.15
50 0.16
51 0.22
52 0.21
53 0.26
54 0.29
55 0.31
56 0.31
57 0.3
58 0.28
59 0.22
60 0.21
61 0.16
62 0.1
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.06
71 0.06
72 0.07
73 0.07
74 0.1
75 0.1
76 0.13
77 0.13
78 0.12
79 0.14
80 0.14
81 0.15
82 0.13
83 0.12
84 0.1
85 0.09
86 0.1
87 0.09
88 0.09
89 0.07
90 0.07
91 0.08
92 0.07
93 0.08
94 0.08
95 0.07
96 0.08
97 0.08
98 0.11
99 0.1
100 0.1
101 0.09
102 0.11
103 0.11
104 0.1
105 0.1
106 0.07
107 0.07
108 0.07
109 0.07
110 0.05
111 0.06
112 0.07
113 0.07
114 0.08
115 0.08
116 0.1
117 0.13
118 0.16
119 0.18
120 0.25
121 0.31
122 0.35
123 0.43
124 0.49
125 0.54
126 0.57
127 0.61
128 0.6
129 0.62
130 0.61
131 0.58
132 0.57
133 0.48
134 0.42
135 0.36
136 0.29
137 0.21
138 0.17
139 0.11
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.03
164 0.04
165 0.03
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.02
184 0.02
185 0.03
186 0.03
187 0.03
188 0.04
189 0.03
190 0.04
191 0.04
192 0.04
193 0.05
194 0.07
195 0.07
196 0.07
197 0.08
198 0.1
199 0.1
200 0.11
201 0.11
202 0.09
203 0.09
204 0.09
205 0.08
206 0.06
207 0.05
208 0.04
209 0.04
210 0.03
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.07
228 0.07
229 0.07
230 0.07
231 0.08
232 0.08
233 0.09
234 0.1
235 0.08
236 0.08
237 0.11
238 0.14
239 0.17
240 0.19
241 0.18
242 0.19
243 0.21
244 0.25
245 0.26
246 0.25
247 0.24
248 0.26
249 0.3
250 0.35
251 0.39
252 0.37
253 0.36
254 0.41
255 0.41
256 0.4
257 0.43
258 0.36
259 0.31
260 0.36
261 0.37
262 0.3
263 0.29
264 0.26
265 0.23
266 0.23
267 0.21
268 0.14
269 0.11
270 0.12
271 0.11
272 0.1
273 0.08
274 0.13
275 0.16
276 0.18
277 0.21
278 0.23
279 0.27
280 0.27
281 0.26
282 0.25
283 0.28
284 0.26
285 0.23
286 0.2
287 0.17
288 0.19
289 0.18
290 0.16
291 0.11
292 0.1
293 0.1
294 0.11
295 0.11
296 0.09
297 0.12
298 0.13
299 0.17
300 0.2
301 0.23
302 0.27
303 0.33
304 0.35
305 0.35
306 0.35
307 0.34
308 0.37
309 0.39
310 0.39
311 0.39
312 0.4
313 0.45
314 0.49
315 0.46
316 0.41
317 0.35
318 0.31
319 0.31
320 0.29
321 0.22
322 0.17
323 0.19
324 0.25
325 0.25
326 0.25
327 0.23
328 0.24
329 0.24
330 0.24