Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Y5Q4

Protein Details
Accession A0A4Y9Y5Q4    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-65IPPDNAGRIRNPKREKREKAERRAARNEEPBasic
NLS Segment(s)
PositionSequence
43-64RIRNPKREKREKAERRAARNEE
70-93GVSRAPRRRPASPSSRARLQDRRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPSPTRALSDQRVADAVRVAPYLTHVVRHHGQLTLIPPDNAGRIRNPKREKREKAERRAARNEEPQFNTGVSRAPRRRPASPSSRARLQDRRRNGGXGDMYIPDYPPPSFDEAISTGSSVALPLPGGVSAADPAAPPSDTVSSTARTSASPSPNSADPPATPGPSTSAIPRSRSRLTFATPAPSPSSPSASSDPRYSTQAEYNSSDADSDSDSADSDIGSLEFVDKEVPPGANQWEQDRLQGLTLEERLARERDRQQRRHAVSDVASSIARALRPSRSQLTIVPTKHTSERQADNHDEYTSASASSPSPSSPHARNASPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.25
4 0.19
5 0.18
6 0.16
7 0.14
8 0.16
9 0.21
10 0.19
11 0.23
12 0.22
13 0.28
14 0.31
15 0.34
16 0.34
17 0.29
18 0.29
19 0.26
20 0.29
21 0.3
22 0.29
23 0.25
24 0.24
25 0.24
26 0.27
27 0.26
28 0.25
29 0.24
30 0.33
31 0.42
32 0.52
33 0.6
34 0.67
35 0.75
36 0.84
37 0.87
38 0.86
39 0.89
40 0.89
41 0.9
42 0.91
43 0.88
44 0.86
45 0.86
46 0.82
47 0.78
48 0.77
49 0.74
50 0.71
51 0.66
52 0.59
53 0.5
54 0.44
55 0.37
56 0.28
57 0.26
58 0.22
59 0.29
60 0.34
61 0.4
62 0.49
63 0.53
64 0.59
65 0.6
66 0.65
67 0.64
68 0.68
69 0.69
70 0.66
71 0.69
72 0.67
73 0.68
74 0.69
75 0.69
76 0.69
77 0.68
78 0.69
79 0.64
80 0.62
81 0.55
82 0.5
83 0.41
84 0.34
85 0.27
86 0.22
87 0.2
88 0.19
89 0.18
90 0.14
91 0.13
92 0.12
93 0.12
94 0.14
95 0.14
96 0.14
97 0.16
98 0.16
99 0.18
100 0.17
101 0.15
102 0.11
103 0.1
104 0.1
105 0.07
106 0.06
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.08
125 0.08
126 0.1
127 0.11
128 0.12
129 0.12
130 0.13
131 0.12
132 0.11
133 0.15
134 0.18
135 0.21
136 0.21
137 0.21
138 0.23
139 0.23
140 0.24
141 0.22
142 0.17
143 0.12
144 0.17
145 0.17
146 0.15
147 0.14
148 0.13
149 0.15
150 0.15
151 0.16
152 0.12
153 0.18
154 0.2
155 0.24
156 0.26
157 0.28
158 0.3
159 0.31
160 0.33
161 0.29
162 0.3
163 0.31
164 0.3
165 0.29
166 0.26
167 0.26
168 0.25
169 0.23
170 0.23
171 0.19
172 0.22
173 0.18
174 0.21
175 0.23
176 0.23
177 0.25
178 0.24
179 0.26
180 0.24
181 0.26
182 0.24
183 0.23
184 0.24
185 0.25
186 0.26
187 0.25
188 0.24
189 0.23
190 0.21
191 0.19
192 0.14
193 0.11
194 0.09
195 0.08
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.06
202 0.05
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.05
210 0.06
211 0.06
212 0.07
213 0.09
214 0.1
215 0.09
216 0.12
217 0.16
218 0.18
219 0.19
220 0.2
221 0.24
222 0.24
223 0.25
224 0.24
225 0.21
226 0.18
227 0.19
228 0.17
229 0.15
230 0.15
231 0.15
232 0.14
233 0.15
234 0.17
235 0.18
236 0.2
237 0.24
238 0.32
239 0.41
240 0.51
241 0.57
242 0.64
243 0.72
244 0.75
245 0.75
246 0.68
247 0.62
248 0.54
249 0.51
250 0.42
251 0.33
252 0.27
253 0.2
254 0.2
255 0.17
256 0.15
257 0.13
258 0.15
259 0.2
260 0.24
261 0.3
262 0.34
263 0.35
264 0.37
265 0.38
266 0.43
267 0.45
268 0.43
269 0.42
270 0.4
271 0.4
272 0.44
273 0.44
274 0.43
275 0.42
276 0.49
277 0.5
278 0.55
279 0.57
280 0.57
281 0.55
282 0.49
283 0.42
284 0.35
285 0.31
286 0.24
287 0.18
288 0.14
289 0.13
290 0.13
291 0.15
292 0.15
293 0.14
294 0.15
295 0.19
296 0.25
297 0.28
298 0.36
299 0.39
300 0.41