Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Y8X0

Protein Details
Accession A0A4Y9Y8X0   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSAPESAPKRRRIQRSPSPTYKLDHydrophilic
NLS Segment(s)
PositionSequence
77-85ERRREKARK
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MSAPESAPKRRRIQRSPSPTYKLDGEDDEYEPYVPVAQRRSAKLAKLASRGANAEKDKAKLLQQEKEEREDEEREEERRREKARKERTLLMEAQEVHSKKAAEGAHAMCLKCISKSHITDCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.84
5 0.81
6 0.72
7 0.67
8 0.59
9 0.51
10 0.43
11 0.36
12 0.31
13 0.28
14 0.27
15 0.25
16 0.23
17 0.2
18 0.17
19 0.15
20 0.13
21 0.11
22 0.13
23 0.14
24 0.19
25 0.23
26 0.25
27 0.32
28 0.32
29 0.33
30 0.36
31 0.39
32 0.38
33 0.38
34 0.39
35 0.34
36 0.32
37 0.32
38 0.28
39 0.28
40 0.24
41 0.24
42 0.23
43 0.23
44 0.22
45 0.22
46 0.23
47 0.24
48 0.26
49 0.27
50 0.3
51 0.37
52 0.38
53 0.4
54 0.39
55 0.33
56 0.33
57 0.29
58 0.26
59 0.23
60 0.23
61 0.23
62 0.27
63 0.29
64 0.3
65 0.35
66 0.4
67 0.43
68 0.5
69 0.58
70 0.64
71 0.71
72 0.72
73 0.72
74 0.72
75 0.69
76 0.62
77 0.54
78 0.47
79 0.38
80 0.35
81 0.34
82 0.29
83 0.25
84 0.26
85 0.24
86 0.19
87 0.25
88 0.23
89 0.18
90 0.23
91 0.23
92 0.28
93 0.31
94 0.31
95 0.25
96 0.28
97 0.26
98 0.23
99 0.24
100 0.23
101 0.28
102 0.33