Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZHH2

Protein Details
Accession A0A4Y9ZHH2   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-31DDTAAPRGSRKTRKRDRVSWPRITGRAHydrophilic
NLS Segment(s)
PositionSequence
11-49RGSRKTRKRDRVSWPRITGRARGPKRAGARLRTGPSTPR
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MSETDDTAAPRGSRKTRKRDRVSWPRITGRARGPKRAGARLRTGPSTPRRAHGSVLEIGFFGCRLSSIRHPADAGAGAGDAATHTRDVDECSMGGSWESTTTVRAPDREPCVESAMSESGRVMMKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.69
4 0.8
5 0.85
6 0.87
7 0.89
8 0.89
9 0.89
10 0.88
11 0.84
12 0.8
13 0.77
14 0.71
15 0.65
16 0.64
17 0.65
18 0.59
19 0.6
20 0.56
21 0.57
22 0.59
23 0.63
24 0.59
25 0.53
26 0.57
27 0.55
28 0.55
29 0.51
30 0.46
31 0.45
32 0.45
33 0.49
34 0.43
35 0.4
36 0.42
37 0.4
38 0.41
39 0.35
40 0.32
41 0.27
42 0.26
43 0.22
44 0.16
45 0.15
46 0.13
47 0.11
48 0.07
49 0.03
50 0.03
51 0.04
52 0.07
53 0.11
54 0.18
55 0.18
56 0.19
57 0.19
58 0.19
59 0.19
60 0.16
61 0.13
62 0.06
63 0.05
64 0.05
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.08
75 0.1
76 0.1
77 0.09
78 0.1
79 0.1
80 0.1
81 0.1
82 0.08
83 0.07
84 0.06
85 0.08
86 0.07
87 0.09
88 0.1
89 0.14
90 0.16
91 0.18
92 0.2
93 0.26
94 0.32
95 0.34
96 0.35
97 0.33
98 0.34
99 0.32
100 0.3
101 0.27
102 0.25
103 0.22
104 0.2
105 0.18
106 0.17
107 0.19