Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YC71

Protein Details
Accession A0A4Y9YC71    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
243-263LANKIRKNKKASSRWLRTKVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR010285  DNA_helicase_pif1-like  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0043139  F:5'-3' DNA helicase activity  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF05970  PIF1  
CDD cd18037  DEXSc_Pif1_like  
cd18809  SF1_C_RecD  
Amino Acid Sequences MSGLASLKRDFSTNAPIKSERDTESQAPAPSKRSKLSASVLKAIELGVATRNSGDGSSMPTTTASTSMLSQKRTFAPGQVAAAPPAKRRQLPDSWKDTGSSTSSQYSSSSYNYTSSSYSYSSSALTATTTWKKAESKPLVIPAAGKSTKAANKKPAAIFLSREQQAILQLVSEGTNVFYTGSAGTGKSVLLREIIKAMQKKYAKSPDAIAITASTGIAACNIGGVTVHSFAGIGLGIESAEDLANKIRKNKKASSRWLRTKVLIVDEVSMIDGDLFDKLARIGSILRRNIEPFGGIQVIVTGDFFQLPPVQKGNQQVKFAFEAEMWKKSVKRTIKLTKVFRQKDQEFVDMLNEMRYGTLSQKSITKFRSLSRDIIYEDGLGPTELFPRRNDVDSSNGVRMSRLRGQNKTYYATDGGTASEEQRKKLLDNFMAPESLYLAVDAQVMLIKNLDETLVNGSMGIIKRFADPASYKTEFEEAILLQEGKPSSSGKKAPTKQQSQQLWPVVEFKVPGGSREVMVLPENWKIELPNGEIQASRTQVESLLMHSVRLVTLTPVLQLPLILAWAMSIHKSQGQTLDRVKVDLAKVFEKGQAYVALSRATSLDGLQVLNFSPDKVFVHDKVRQWSASLETLDFPDGND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.44
4 0.45
5 0.48
6 0.49
7 0.42
8 0.4
9 0.43
10 0.41
11 0.44
12 0.47
13 0.45
14 0.45
15 0.44
16 0.45
17 0.47
18 0.49
19 0.47
20 0.47
21 0.46
22 0.48
23 0.53
24 0.55
25 0.53
26 0.55
27 0.52
28 0.47
29 0.44
30 0.37
31 0.29
32 0.2
33 0.16
34 0.12
35 0.12
36 0.12
37 0.12
38 0.12
39 0.12
40 0.12
41 0.12
42 0.09
43 0.14
44 0.16
45 0.16
46 0.16
47 0.16
48 0.17
49 0.16
50 0.17
51 0.12
52 0.11
53 0.13
54 0.22
55 0.26
56 0.29
57 0.3
58 0.34
59 0.36
60 0.39
61 0.38
62 0.33
63 0.35
64 0.34
65 0.35
66 0.34
67 0.32
68 0.3
69 0.34
70 0.32
71 0.3
72 0.34
73 0.37
74 0.37
75 0.41
76 0.46
77 0.51
78 0.59
79 0.63
80 0.64
81 0.62
82 0.59
83 0.56
84 0.5
85 0.43
86 0.37
87 0.3
88 0.25
89 0.25
90 0.24
91 0.24
92 0.23
93 0.22
94 0.21
95 0.21
96 0.2
97 0.18
98 0.19
99 0.2
100 0.21
101 0.19
102 0.18
103 0.19
104 0.18
105 0.18
106 0.17
107 0.17
108 0.15
109 0.15
110 0.13
111 0.11
112 0.1
113 0.09
114 0.15
115 0.19
116 0.2
117 0.21
118 0.25
119 0.29
120 0.33
121 0.43
122 0.43
123 0.44
124 0.46
125 0.51
126 0.49
127 0.45
128 0.42
129 0.33
130 0.35
131 0.29
132 0.25
133 0.2
134 0.26
135 0.31
136 0.37
137 0.41
138 0.41
139 0.46
140 0.53
141 0.54
142 0.53
143 0.5
144 0.45
145 0.43
146 0.38
147 0.41
148 0.35
149 0.34
150 0.28
151 0.25
152 0.25
153 0.22
154 0.17
155 0.09
156 0.09
157 0.09
158 0.09
159 0.08
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.05
166 0.06
167 0.06
168 0.07
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.08
175 0.09
176 0.09
177 0.1
178 0.11
179 0.11
180 0.13
181 0.15
182 0.18
183 0.22
184 0.23
185 0.29
186 0.31
187 0.33
188 0.4
189 0.47
190 0.44
191 0.41
192 0.42
193 0.41
194 0.39
195 0.37
196 0.28
197 0.19
198 0.17
199 0.16
200 0.13
201 0.07
202 0.05
203 0.04
204 0.04
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.04
212 0.05
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.05
220 0.04
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.04
230 0.07
231 0.11
232 0.12
233 0.21
234 0.28
235 0.35
236 0.42
237 0.5
238 0.57
239 0.63
240 0.73
241 0.76
242 0.79
243 0.82
244 0.82
245 0.77
246 0.68
247 0.63
248 0.54
249 0.46
250 0.38
251 0.28
252 0.22
253 0.19
254 0.18
255 0.13
256 0.1
257 0.07
258 0.05
259 0.04
260 0.03
261 0.03
262 0.03
263 0.03
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.07
270 0.13
271 0.2
272 0.21
273 0.23
274 0.23
275 0.25
276 0.25
277 0.23
278 0.17
279 0.11
280 0.11
281 0.1
282 0.09
283 0.07
284 0.07
285 0.07
286 0.06
287 0.06
288 0.04
289 0.04
290 0.04
291 0.04
292 0.05
293 0.07
294 0.09
295 0.1
296 0.12
297 0.12
298 0.15
299 0.23
300 0.32
301 0.33
302 0.35
303 0.34
304 0.34
305 0.35
306 0.32
307 0.25
308 0.16
309 0.18
310 0.17
311 0.19
312 0.18
313 0.18
314 0.19
315 0.2
316 0.28
317 0.27
318 0.3
319 0.37
320 0.45
321 0.53
322 0.6
323 0.65
324 0.66
325 0.71
326 0.69
327 0.65
328 0.65
329 0.57
330 0.57
331 0.53
332 0.47
333 0.37
334 0.34
335 0.3
336 0.21
337 0.2
338 0.12
339 0.09
340 0.07
341 0.06
342 0.06
343 0.06
344 0.08
345 0.1
346 0.11
347 0.11
348 0.16
349 0.18
350 0.23
351 0.24
352 0.26
353 0.25
354 0.28
355 0.36
356 0.34
357 0.36
358 0.33
359 0.34
360 0.3
361 0.29
362 0.26
363 0.18
364 0.16
365 0.12
366 0.1
367 0.08
368 0.07
369 0.06
370 0.1
371 0.12
372 0.13
373 0.13
374 0.18
375 0.2
376 0.22
377 0.23
378 0.2
379 0.23
380 0.27
381 0.3
382 0.26
383 0.25
384 0.23
385 0.22
386 0.22
387 0.22
388 0.25
389 0.3
390 0.34
391 0.38
392 0.42
393 0.48
394 0.49
395 0.48
396 0.42
397 0.36
398 0.32
399 0.27
400 0.24
401 0.18
402 0.15
403 0.12
404 0.12
405 0.11
406 0.17
407 0.18
408 0.18
409 0.2
410 0.2
411 0.2
412 0.26
413 0.31
414 0.27
415 0.3
416 0.32
417 0.31
418 0.3
419 0.29
420 0.23
421 0.17
422 0.14
423 0.1
424 0.07
425 0.06
426 0.06
427 0.06
428 0.06
429 0.05
430 0.06
431 0.06
432 0.06
433 0.06
434 0.06
435 0.06
436 0.06
437 0.06
438 0.05
439 0.05
440 0.09
441 0.09
442 0.09
443 0.09
444 0.09
445 0.12
446 0.13
447 0.13
448 0.1
449 0.1
450 0.11
451 0.13
452 0.13
453 0.14
454 0.15
455 0.17
456 0.25
457 0.26
458 0.26
459 0.26
460 0.27
461 0.22
462 0.21
463 0.2
464 0.12
465 0.12
466 0.13
467 0.12
468 0.1
469 0.13
470 0.13
471 0.11
472 0.12
473 0.13
474 0.14
475 0.2
476 0.25
477 0.3
478 0.4
479 0.45
480 0.54
481 0.62
482 0.68
483 0.68
484 0.73
485 0.73
486 0.69
487 0.72
488 0.68
489 0.59
490 0.52
491 0.48
492 0.39
493 0.33
494 0.27
495 0.19
496 0.21
497 0.19
498 0.19
499 0.21
500 0.21
501 0.2
502 0.21
503 0.21
504 0.15
505 0.16
506 0.17
507 0.15
508 0.18
509 0.18
510 0.17
511 0.17
512 0.16
513 0.18
514 0.2
515 0.22
516 0.23
517 0.24
518 0.24
519 0.24
520 0.26
521 0.27
522 0.25
523 0.21
524 0.17
525 0.16
526 0.16
527 0.18
528 0.16
529 0.13
530 0.19
531 0.18
532 0.17
533 0.17
534 0.17
535 0.15
536 0.15
537 0.14
538 0.08
539 0.1
540 0.11
541 0.12
542 0.12
543 0.12
544 0.11
545 0.11
546 0.1
547 0.07
548 0.07
549 0.06
550 0.05
551 0.05
552 0.06
553 0.07
554 0.08
555 0.08
556 0.09
557 0.13
558 0.15
559 0.17
560 0.24
561 0.26
562 0.32
563 0.36
564 0.42
565 0.39
566 0.39
567 0.38
568 0.35
569 0.34
570 0.32
571 0.31
572 0.26
573 0.27
574 0.28
575 0.31
576 0.27
577 0.25
578 0.23
579 0.22
580 0.22
581 0.23
582 0.23
583 0.21
584 0.19
585 0.19
586 0.17
587 0.15
588 0.13
589 0.11
590 0.12
591 0.12
592 0.12
593 0.12
594 0.12
595 0.11
596 0.15
597 0.15
598 0.13
599 0.12
600 0.14
601 0.16
602 0.2
603 0.26
604 0.26
605 0.34
606 0.4
607 0.45
608 0.51
609 0.54
610 0.49
611 0.45
612 0.45
613 0.41
614 0.4
615 0.36
616 0.3
617 0.27
618 0.28
619 0.29