FuNGI

A0A4Y9Y1F7

Protein Details

Accession

A0A4Y9Y1F7

Localization Confidence

Low

Confidence Score

9.1

NoLS Segment(s)

Position	Sequence	Protein Nature
407-435	CGAPRVARLRRAQRRHHLHRRLPRDLRAA	Basic

NLS Segment(s)

Position	Sequence
413-449	VARLRRAQRRHHLHRRLPRDLRAAQRRAHQPRARMHA

Subcellular Location(s)

mito 7, extr 7, cyto 4.5, cyto_nucl 4.5, nucl 3.5, plas 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR046522 DUF6699
Pfam	View protein in Pfam PF20415 DUF6699

Amino Acid Sequences

MPGPWQYTSTHRLPAIFPWQRFCPLFEFLGRSEGSEAVALQRRHIACFHQTRISQDSPHSSRPCPLKLVCSTHFFKHRADVRGMQRPEELCDSPARRRRHEVLVLSAGAPRATGIKACTTPPPSPLLPSRTVHPAAPATLSPCTRTCRDLDAQDPEDXGVLHDDPAGPAHGQDPPARGGRGVAAAAAVRDTPGSLWHGLLVPRPSPAPVQPRQRLLHVPRGAGPVHQAQAQGPVPDVRHHGLVLVCIVGLDISTVIEDAPPIGCAHEHAKGHSEARADVDRDGYASSPEKQRAAASRAHPAPTRSAVPARGPPTPPGMPIRDNIRIPGAPLTGVPPAAPAPPAALHWKLLPFSYPKCKARVSFDVRFHAEHIDLIDALARTPRRPLTVTERKKPASEPALNEMTIPLCGAPRVARLRRAQRRHHLHRRLPRDLRAAQRRAHQPRARMHADRLRGAHAAFEERCRRASMLEREKGYRRFDLLAGKSYFGGLDWVAPSKEFPDGYWALLLSSKDELRC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.41
2	0.45
3	0.47
4	0.45
5	0.44
6	0.46
7	0.51
8	0.51
9	0.46
10	0.4
11	0.36
12	0.36
13	0.34
14	0.35
15	0.29
16	0.33
17	0.3
18	0.27
19	0.25
20	0.22
21	0.2
22	0.16
23	0.15
24	0.16
25	0.24
26	0.23
27	0.22
28	0.3
29	0.3
30	0.31
31	0.33
32	0.31
33	0.33
34	0.42
35	0.45
36	0.45
37	0.46
38	0.49
39	0.54
40	0.53
41	0.46
42	0.42
43	0.47
44	0.45
45	0.53
46	0.52
47	0.47
48	0.5
49	0.54
50	0.53
51	0.5
52	0.47
53	0.46
54	0.49
55	0.55
56	0.52
57	0.51
58	0.52
59	0.52
60	0.58
61	0.52
62	0.46
63	0.48
64	0.52
65	0.5
66	0.52
67	0.54
68	0.53
69	0.61
70	0.61
71	0.53
72	0.5
73	0.46
74	0.45
75	0.42
76	0.35
77	0.27
78	0.33
79	0.36
80	0.4
81	0.47
82	0.5
83	0.49
84	0.56
85	0.6
86	0.61
87	0.65
88	0.59
89	0.58
90	0.56
91	0.51
92	0.44
93	0.4
94	0.31
95	0.23
96	0.18
97	0.12
98	0.09
99	0.09
100	0.1
101	0.1
102	0.14
103	0.16
104	0.18
105	0.24
106	0.27
107	0.28
108	0.29
109	0.33
110	0.28
111	0.31
112	0.36
113	0.35
114	0.35
115	0.34
116	0.35
117	0.37
118	0.38
119	0.34
120	0.31
121	0.27
122	0.23
123	0.24
124	0.21
125	0.17
126	0.2
127	0.2
128	0.19
129	0.21
130	0.24
131	0.24
132	0.26
133	0.25
134	0.28
135	0.31
136	0.32
137	0.34
138	0.37
139	0.38
140	0.36
141	0.34
142	0.28
143	0.24
144	0.2
145	0.17
146	0.1
147	0.08
148	0.08
149	0.08
150	0.08
151	0.08
152	0.09
153	0.07
154	0.07
155	0.08
156	0.1
157	0.11
158	0.13
159	0.15
160	0.17
161	0.19
162	0.19
163	0.18
164	0.16
165	0.15
166	0.15
167	0.12
168	0.09
169	0.07
170	0.07
171	0.07
172	0.07
173	0.06
174	0.04
175	0.04
176	0.04
177	0.04
178	0.05
179	0.08
180	0.08
181	0.08
182	0.09
183	0.1
184	0.11
185	0.14
186	0.15
187	0.13
188	0.13
189	0.14
190	0.14
191	0.14
192	0.19
193	0.23
194	0.28
195	0.38
196	0.41
197	0.48
198	0.48
199	0.5
200	0.53
201	0.49
202	0.52
203	0.45
204	0.42
205	0.37
206	0.39
207	0.36
208	0.28
209	0.26
210	0.19
211	0.17
212	0.17
213	0.15
214	0.12
215	0.17
216	0.18
217	0.15
218	0.13
219	0.14
220	0.13
221	0.14
222	0.17
223	0.13
224	0.13
225	0.12
226	0.13
227	0.12
228	0.11
229	0.1
230	0.07
231	0.06
232	0.05
233	0.05
234	0.03
235	0.03
236	0.02
237	0.02
238	0.02
239	0.02
240	0.02
241	0.02
242	0.03
243	0.03
244	0.03
245	0.03
246	0.04
247	0.04
248	0.04
249	0.04
250	0.05
251	0.08
252	0.12
253	0.12
254	0.12
255	0.15
256	0.17
257	0.18
258	0.18
259	0.17
260	0.13
261	0.16
262	0.18
263	0.16
264	0.15
265	0.15
266	0.13
267	0.12
268	0.12
269	0.09
270	0.09
271	0.09
272	0.12
273	0.15
274	0.17
275	0.17
276	0.17
277	0.19
278	0.22
279	0.24
280	0.27
281	0.25
282	0.31
283	0.32
284	0.34
285	0.34
286	0.3
287	0.31
288	0.27
289	0.27
290	0.22
291	0.22
292	0.22
293	0.23
294	0.27
295	0.27
296	0.28
297	0.28
298	0.27
299	0.3
300	0.29
301	0.28
302	0.27
303	0.27
304	0.25
305	0.26
306	0.3
307	0.29
308	0.29
309	0.28
310	0.27
311	0.24
312	0.23
313	0.23
314	0.18
315	0.13
316	0.13
317	0.14
318	0.11
319	0.11
320	0.1
321	0.08
322	0.08
323	0.09
324	0.09
325	0.07
326	0.07
327	0.08
328	0.1
329	0.13
330	0.13
331	0.14
332	0.15
333	0.16
334	0.16
335	0.15
336	0.17
337	0.16
338	0.21
339	0.3
340	0.36
341	0.38
342	0.41
343	0.45
344	0.45
345	0.49
346	0.54
347	0.53
348	0.53
349	0.56
350	0.58
351	0.56
352	0.54
353	0.47
354	0.39
355	0.31
356	0.23
357	0.18
358	0.13
359	0.11
360	0.1
361	0.11
362	0.09
363	0.08
364	0.12
365	0.12
366	0.12
367	0.17
368	0.19
369	0.2
370	0.22
371	0.27
372	0.33
373	0.44
374	0.52
375	0.56
376	0.62
377	0.61
378	0.61
379	0.58
380	0.56
381	0.54
382	0.52
383	0.47
384	0.45
385	0.46
386	0.44
387	0.42
388	0.34
389	0.25
390	0.19
391	0.15
392	0.09
393	0.06
394	0.06
395	0.08
396	0.08
397	0.15
398	0.24
399	0.28
400	0.35
401	0.43
402	0.54
403	0.64
404	0.72
405	0.75
406	0.76
407	0.84
408	0.87
409	0.9
410	0.9
411	0.89
412	0.9
413	0.89
414	0.89
415	0.85
416	0.82
417	0.79
418	0.75
419	0.76
420	0.76
421	0.72
422	0.66
423	0.68
424	0.71
425	0.71
426	0.74
427	0.69
428	0.67
429	0.69
430	0.74
431	0.72
432	0.66
433	0.66
434	0.63
435	0.64
436	0.62
437	0.55
438	0.5
439	0.45
440	0.41
441	0.35
442	0.29
443	0.3
444	0.26
445	0.32
446	0.36
447	0.36
448	0.37
449	0.37
450	0.36
451	0.34
452	0.42
453	0.45
454	0.48
455	0.53
456	0.55
457	0.58
458	0.66
459	0.68
460	0.63
461	0.57
462	0.5
463	0.46
464	0.45
465	0.49
466	0.45
467	0.48
468	0.44
469	0.4
470	0.37
471	0.34
472	0.3
473	0.21
474	0.19
475	0.1
476	0.11
477	0.12
478	0.15
479	0.15
480	0.16
481	0.16
482	0.16
483	0.2
484	0.17
485	0.16
486	0.21
487	0.22
488	0.23
489	0.24
490	0.22
491	0.18
492	0.22
493	0.21
494	0.16
495	0.19

A0A4Y9Y1F7

3D AlphaFold-predicted Structure Viewer