Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YS25

Protein Details
Accession A0A4Y9YS25    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-76PQQAESSKPSHKRKSRKDTTKAPRKASQHydrophilic
NLS Segment(s)
PositionSequence
56-76KPSHKRKSRKDTTKAPRKASQ
92-97KKKSKT
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSAVFGGESGYPGYNPPTTAPSTSPRGGKAGSPENNIIHLSPYQPPATPQQAESSKPSHKRKSRKDTTKAPRKASQPAPAPPADDSDQEHAKKKSKTDEEKRLRKALQAQFYRAQHAEAVRHLEDALPEAYKTHDDPPGRETVAQDVKYIKDTPAIRERNVELSRELEQRNLELRIVKKERDDAKGFLRVTRDELNLSKFVIMQREGEIGRLQNRVNYLESMLAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.19
5 0.21
6 0.23
7 0.26
8 0.28
9 0.33
10 0.36
11 0.37
12 0.34
13 0.35
14 0.33
15 0.32
16 0.34
17 0.37
18 0.38
19 0.4
20 0.42
21 0.39
22 0.4
23 0.39
24 0.32
25 0.24
26 0.2
27 0.18
28 0.18
29 0.2
30 0.19
31 0.19
32 0.21
33 0.25
34 0.3
35 0.29
36 0.27
37 0.31
38 0.33
39 0.36
40 0.37
41 0.36
42 0.38
43 0.46
44 0.54
45 0.57
46 0.62
47 0.71
48 0.78
49 0.84
50 0.87
51 0.88
52 0.88
53 0.89
54 0.91
55 0.91
56 0.88
57 0.83
58 0.78
59 0.72
60 0.72
61 0.67
62 0.64
63 0.6
64 0.56
65 0.54
66 0.48
67 0.45
68 0.37
69 0.34
70 0.27
71 0.22
72 0.2
73 0.19
74 0.24
75 0.24
76 0.29
77 0.28
78 0.33
79 0.34
80 0.36
81 0.41
82 0.45
83 0.54
84 0.59
85 0.67
86 0.71
87 0.77
88 0.79
89 0.75
90 0.66
91 0.59
92 0.59
93 0.54
94 0.52
95 0.46
96 0.45
97 0.45
98 0.45
99 0.44
100 0.35
101 0.29
102 0.22
103 0.2
104 0.18
105 0.13
106 0.17
107 0.14
108 0.14
109 0.13
110 0.12
111 0.11
112 0.11
113 0.11
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.1
120 0.11
121 0.16
122 0.16
123 0.18
124 0.2
125 0.24
126 0.23
127 0.22
128 0.2
129 0.22
130 0.28
131 0.27
132 0.25
133 0.23
134 0.23
135 0.25
136 0.26
137 0.19
138 0.19
139 0.19
140 0.24
141 0.32
142 0.35
143 0.33
144 0.35
145 0.37
146 0.39
147 0.4
148 0.35
149 0.27
150 0.26
151 0.3
152 0.31
153 0.3
154 0.24
155 0.23
156 0.24
157 0.26
158 0.25
159 0.23
160 0.22
161 0.25
162 0.32
163 0.35
164 0.35
165 0.35
166 0.41
167 0.46
168 0.48
169 0.49
170 0.43
171 0.45
172 0.5
173 0.47
174 0.42
175 0.4
176 0.34
177 0.35
178 0.36
179 0.32
180 0.28
181 0.31
182 0.32
183 0.3
184 0.29
185 0.25
186 0.22
187 0.23
188 0.24
189 0.22
190 0.19
191 0.2
192 0.24
193 0.23
194 0.23
195 0.24
196 0.23
197 0.26
198 0.28
199 0.27
200 0.26
201 0.28
202 0.29
203 0.29
204 0.27
205 0.24
206 0.22