Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Y3I0

Protein Details
Accession A0A4Y9Y3I0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPVRHQTKYQRKRIALRALLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
Amino Acid Sequences MAPVRHQTKYQRKRIALRALLRRLIRASLVQITGNPKARMSWTKYWRLVVLRYGVDIVGWPDDIPFMDPSKVSLGRTRLLPLVQSWEDGLTCFVKLTDAELAAKEAERKAKIAAGEIVLPAPRALRADFGDRRPHAQKGPAGRHCKKIFYSKSARFITASDELALDEEEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.82
4 0.8
5 0.8
6 0.76
7 0.75
8 0.67
9 0.6
10 0.51
11 0.44
12 0.37
13 0.29
14 0.26
15 0.23
16 0.24
17 0.21
18 0.22
19 0.25
20 0.29
21 0.34
22 0.3
23 0.26
24 0.26
25 0.31
26 0.35
27 0.38
28 0.42
29 0.43
30 0.52
31 0.54
32 0.55
33 0.54
34 0.5
35 0.45
36 0.39
37 0.36
38 0.27
39 0.24
40 0.23
41 0.19
42 0.15
43 0.13
44 0.1
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.06
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.1
57 0.14
58 0.15
59 0.14
60 0.17
61 0.18
62 0.19
63 0.2
64 0.2
65 0.18
66 0.17
67 0.16
68 0.13
69 0.16
70 0.14
71 0.14
72 0.12
73 0.11
74 0.11
75 0.1
76 0.11
77 0.06
78 0.06
79 0.06
80 0.05
81 0.06
82 0.05
83 0.07
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.08
90 0.09
91 0.09
92 0.09
93 0.13
94 0.13
95 0.14
96 0.14
97 0.16
98 0.16
99 0.17
100 0.17
101 0.13
102 0.13
103 0.13
104 0.13
105 0.1
106 0.1
107 0.08
108 0.07
109 0.07
110 0.08
111 0.08
112 0.1
113 0.12
114 0.2
115 0.25
116 0.29
117 0.38
118 0.37
119 0.43
120 0.44
121 0.46
122 0.41
123 0.43
124 0.44
125 0.45
126 0.54
127 0.57
128 0.63
129 0.63
130 0.7
131 0.66
132 0.67
133 0.62
134 0.62
135 0.6
136 0.6
137 0.66
138 0.64
139 0.7
140 0.68
141 0.65
142 0.55
143 0.49
144 0.46
145 0.39
146 0.33
147 0.24
148 0.21
149 0.19
150 0.19