Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XWY5

Protein Details
Accession A0A4Y9XWY5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
11-37TPSPSTSVSRHPSRSRRHESKAAPAKPHydrophilic
NLS Segment(s)
PositionSequence
25-35SRRHESKAAPA
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
Amino Acid Sequences MPHPYSEESLTPSPSTSVSRHPSRSRRHESKAAPAKPLVPNRPSIEKPLPSRPAEGTELTSSRHFIKQENIITLVLGGHAGDSQAPMYTSGSIVTGLVTLSKVSSIISVKVRMEGSIRVREVAGGGSGVTQLLSDTLYSWDHQLHQGPAPYEFTFRAQVPTHHEDLSRGRQLLPPSFDSRLTAIPGFRVSVQYEFIVAVTRVRMGPLLWRRQTRLRVPFTYKPLTRPPVSAPLTLRPNTSKRGDILFNDMISSADRDAPPIETQIYLPGSQITPITERINFRITLSAPDAYLTPFLFDPSPLSSFHPISTQSVTSLASSLPGSVRQPLLGSSRRRAXAGVVVLHPKGRFVAARTPLAEGYVFQAEKGPGWVSWWGEVSVPPDGQCCGFTTSKLSVKVRVWPLATARLIVAVPEMRCADRLAAGAQDVLVLHVNAPAVHTHVLPFRQSVPIRLTSCSAKSTSATKVYEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.23
4 0.29
5 0.35
6 0.42
7 0.5
8 0.59
9 0.66
10 0.73
11 0.81
12 0.82
13 0.83
14 0.84
15 0.85
16 0.81
17 0.82
18 0.82
19 0.76
20 0.7
21 0.63
22 0.61
23 0.6
24 0.64
25 0.61
26 0.54
27 0.56
28 0.55
29 0.61
30 0.56
31 0.57
32 0.56
33 0.55
34 0.58
35 0.61
36 0.64
37 0.58
38 0.6
39 0.54
40 0.5
41 0.47
42 0.42
43 0.36
44 0.33
45 0.32
46 0.31
47 0.29
48 0.26
49 0.26
50 0.28
51 0.26
52 0.24
53 0.29
54 0.35
55 0.39
56 0.4
57 0.39
58 0.35
59 0.33
60 0.31
61 0.24
62 0.15
63 0.1
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.08
75 0.09
76 0.08
77 0.08
78 0.09
79 0.08
80 0.08
81 0.07
82 0.06
83 0.05
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.08
92 0.09
93 0.13
94 0.16
95 0.2
96 0.2
97 0.24
98 0.24
99 0.21
100 0.22
101 0.24
102 0.26
103 0.3
104 0.3
105 0.27
106 0.27
107 0.26
108 0.25
109 0.19
110 0.14
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.07
124 0.08
125 0.08
126 0.09
127 0.1
128 0.12
129 0.14
130 0.17
131 0.17
132 0.19
133 0.22
134 0.21
135 0.21
136 0.23
137 0.21
138 0.2
139 0.19
140 0.18
141 0.18
142 0.17
143 0.21
144 0.18
145 0.21
146 0.27
147 0.31
148 0.31
149 0.29
150 0.29
151 0.28
152 0.32
153 0.37
154 0.32
155 0.28
156 0.27
157 0.29
158 0.32
159 0.34
160 0.32
161 0.29
162 0.28
163 0.29
164 0.29
165 0.27
166 0.25
167 0.21
168 0.2
169 0.17
170 0.14
171 0.13
172 0.13
173 0.13
174 0.11
175 0.12
176 0.11
177 0.11
178 0.12
179 0.11
180 0.11
181 0.1
182 0.1
183 0.09
184 0.08
185 0.07
186 0.06
187 0.07
188 0.07
189 0.07
190 0.07
191 0.06
192 0.14
193 0.2
194 0.28
195 0.32
196 0.34
197 0.38
198 0.44
199 0.51
200 0.51
201 0.53
202 0.51
203 0.52
204 0.57
205 0.59
206 0.59
207 0.59
208 0.52
209 0.47
210 0.48
211 0.47
212 0.42
213 0.38
214 0.35
215 0.37
216 0.38
217 0.36
218 0.31
219 0.32
220 0.35
221 0.34
222 0.32
223 0.27
224 0.27
225 0.29
226 0.3
227 0.26
228 0.23
229 0.25
230 0.26
231 0.23
232 0.27
233 0.23
234 0.21
235 0.2
236 0.18
237 0.15
238 0.14
239 0.13
240 0.07
241 0.09
242 0.08
243 0.09
244 0.1
245 0.11
246 0.11
247 0.11
248 0.11
249 0.09
250 0.09
251 0.11
252 0.12
253 0.11
254 0.1
255 0.11
256 0.1
257 0.1
258 0.1
259 0.08
260 0.09
261 0.11
262 0.13
263 0.14
264 0.16
265 0.18
266 0.2
267 0.19
268 0.18
269 0.19
270 0.18
271 0.19
272 0.2
273 0.18
274 0.15
275 0.15
276 0.15
277 0.12
278 0.12
279 0.09
280 0.08
281 0.07
282 0.08
283 0.08
284 0.08
285 0.09
286 0.11
287 0.12
288 0.12
289 0.15
290 0.18
291 0.18
292 0.19
293 0.19
294 0.18
295 0.19
296 0.2
297 0.17
298 0.14
299 0.15
300 0.15
301 0.13
302 0.12
303 0.09
304 0.08
305 0.08
306 0.08
307 0.08
308 0.09
309 0.1
310 0.12
311 0.12
312 0.11
313 0.12
314 0.13
315 0.19
316 0.24
317 0.27
318 0.29
319 0.34
320 0.34
321 0.34
322 0.32
323 0.28
324 0.27
325 0.25
326 0.28
327 0.28
328 0.28
329 0.3
330 0.3
331 0.28
332 0.23
333 0.22
334 0.17
335 0.15
336 0.23
337 0.26
338 0.3
339 0.3
340 0.32
341 0.3
342 0.29
343 0.26
344 0.17
345 0.15
346 0.17
347 0.15
348 0.13
349 0.17
350 0.16
351 0.16
352 0.18
353 0.16
354 0.11
355 0.13
356 0.16
357 0.14
358 0.15
359 0.16
360 0.15
361 0.14
362 0.16
363 0.16
364 0.17
365 0.16
366 0.15
367 0.14
368 0.15
369 0.15
370 0.14
371 0.14
372 0.16
373 0.16
374 0.16
375 0.2
376 0.25
377 0.3
378 0.36
379 0.36
380 0.38
381 0.39
382 0.47
383 0.48
384 0.47
385 0.43
386 0.4
387 0.41
388 0.42
389 0.41
390 0.33
391 0.27
392 0.24
393 0.22
394 0.19
395 0.18
396 0.15
397 0.14
398 0.17
399 0.19
400 0.17
401 0.18
402 0.2
403 0.18
404 0.16
405 0.17
406 0.15
407 0.15
408 0.14
409 0.14
410 0.12
411 0.12
412 0.09
413 0.09
414 0.09
415 0.08
416 0.08
417 0.09
418 0.1
419 0.09
420 0.1
421 0.09
422 0.11
423 0.12
424 0.13
425 0.14
426 0.19
427 0.21
428 0.22
429 0.24
430 0.23
431 0.31
432 0.32
433 0.35
434 0.35
435 0.41
436 0.41
437 0.41
438 0.42
439 0.39
440 0.41
441 0.39
442 0.36
443 0.3
444 0.3
445 0.33
446 0.36
447 0.38