Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YJ61

Protein Details
Accession A0A4Y9YJ61   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
552-574EEQPGMRKKRSEGRKSRGTPLLSHydrophilic
NLS Segment(s)
PositionSequence
559-577MRKKRSEGRKSRGTPLLSR
Subcellular Location(s) cyto 9, extr 7, nucl 4, pero 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR013094  AB_hydrolase_3  
IPR033140  Lipase_GDXG_put_SER_AS  
Gene Ontology GO:0016020  C:membrane  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF07859  Abhydrolase_3  
PROSITE View protein in PROSITE  
PS01174  LIPASE_GDXG_SER  
Amino Acid Sequences MYEWREQPWKTLYLLYELLVTLLIRIPFWMLYYLPPCTRPRXTWTLRRTITLRIVNRLVIITGRTGELTSTPDHITIACGAHIKHVWLDPFPSSLLTPELQSYAXAADVEPVSIPGYWLDAPDFSSTPANQRAQPGERVLLMLHGGAYTRLSASPDHALAHVTRGLLAHCHQAPANVRRALAPEYRLSRAAPFASTSANAFPAALLDALAGYRHLVHDLGFKPADIVIAGDSAGGNLALALVRYLVENYKRVDGDESKNGEVQVDGGRESESVPAPPGTLILLSPWVDMSASHHHAGASSITNAHADYLGDADGPALHYSVTAFLGQLGSAGARTNRFVSPACADPAIGSVPFVGWPRTFVVAGEAELLRDQIRALVRKMEGDMGRGSGEGQVEYWEEDGAVHDYLVFLFHEPERTRTLEGIARWMGVKPAEETEAISIAASVTCKQPSLADHRVLEYISGSLRTTIGRAPKNSRHFAVDSIPHRPQWSCRYRAFFVFNTFESSVQKRISETTSCEAACARADGNRTRCTPLRATTTKSTEKSRGHLPIDKQHEEQPGMRKKRSEGRKSRGTPLLSRRPRFTYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.25
4 0.21
5 0.2
6 0.15
7 0.14
8 0.09
9 0.11
10 0.11
11 0.1
12 0.1
13 0.11
14 0.11
15 0.13
16 0.13
17 0.11
18 0.16
19 0.2
20 0.25
21 0.26
22 0.31
23 0.33
24 0.39
25 0.42
26 0.42
27 0.47
28 0.53
29 0.6
30 0.64
31 0.7
32 0.72
33 0.73
34 0.72
35 0.71
36 0.69
37 0.68
38 0.63
39 0.6
40 0.53
41 0.49
42 0.46
43 0.39
44 0.31
45 0.23
46 0.2
47 0.15
48 0.13
49 0.13
50 0.12
51 0.12
52 0.12
53 0.12
54 0.13
55 0.13
56 0.15
57 0.15
58 0.15
59 0.16
60 0.15
61 0.15
62 0.15
63 0.14
64 0.12
65 0.14
66 0.14
67 0.18
68 0.19
69 0.18
70 0.18
71 0.21
72 0.21
73 0.2
74 0.23
75 0.2
76 0.2
77 0.2
78 0.18
79 0.15
80 0.15
81 0.16
82 0.14
83 0.14
84 0.13
85 0.14
86 0.13
87 0.12
88 0.12
89 0.1
90 0.1
91 0.09
92 0.08
93 0.07
94 0.08
95 0.08
96 0.07
97 0.07
98 0.06
99 0.07
100 0.07
101 0.09
102 0.08
103 0.09
104 0.1
105 0.09
106 0.11
107 0.13
108 0.13
109 0.13
110 0.16
111 0.15
112 0.2
113 0.27
114 0.28
115 0.27
116 0.31
117 0.36
118 0.36
119 0.4
120 0.37
121 0.32
122 0.29
123 0.28
124 0.23
125 0.18
126 0.15
127 0.11
128 0.08
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.08
137 0.08
138 0.11
139 0.14
140 0.14
141 0.15
142 0.14
143 0.15
144 0.14
145 0.16
146 0.15
147 0.12
148 0.11
149 0.11
150 0.11
151 0.12
152 0.13
153 0.16
154 0.15
155 0.16
156 0.16
157 0.2
158 0.26
159 0.29
160 0.36
161 0.32
162 0.32
163 0.32
164 0.34
165 0.34
166 0.3
167 0.28
168 0.25
169 0.27
170 0.29
171 0.29
172 0.27
173 0.25
174 0.24
175 0.22
176 0.18
177 0.15
178 0.14
179 0.14
180 0.14
181 0.13
182 0.11
183 0.11
184 0.11
185 0.09
186 0.08
187 0.07
188 0.07
189 0.06
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.03
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.12
203 0.13
204 0.17
205 0.16
206 0.16
207 0.16
208 0.16
209 0.15
210 0.09
211 0.08
212 0.05
213 0.05
214 0.05
215 0.04
216 0.04
217 0.04
218 0.04
219 0.03
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.03
227 0.03
228 0.03
229 0.04
230 0.07
231 0.09
232 0.11
233 0.13
234 0.16
235 0.16
236 0.16
237 0.19
238 0.21
239 0.24
240 0.28
241 0.3
242 0.28
243 0.28
244 0.28
245 0.24
246 0.19
247 0.17
248 0.12
249 0.1
250 0.09
251 0.08
252 0.09
253 0.09
254 0.09
255 0.1
256 0.08
257 0.08
258 0.08
259 0.08
260 0.08
261 0.08
262 0.07
263 0.06
264 0.05
265 0.05
266 0.04
267 0.06
268 0.06
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.09
275 0.12
276 0.15
277 0.15
278 0.15
279 0.15
280 0.15
281 0.16
282 0.14
283 0.09
284 0.07
285 0.07
286 0.07
287 0.08
288 0.07
289 0.07
290 0.06
291 0.05
292 0.05
293 0.05
294 0.05
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.06
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.04
314 0.03
315 0.04
316 0.04
317 0.05
318 0.06
319 0.07
320 0.09
321 0.1
322 0.11
323 0.12
324 0.14
325 0.16
326 0.17
327 0.17
328 0.15
329 0.15
330 0.13
331 0.13
332 0.11
333 0.09
334 0.07
335 0.05
336 0.05
337 0.07
338 0.08
339 0.08
340 0.07
341 0.09
342 0.11
343 0.12
344 0.12
345 0.11
346 0.13
347 0.11
348 0.12
349 0.12
350 0.1
351 0.09
352 0.09
353 0.09
354 0.07
355 0.07
356 0.06
357 0.08
358 0.11
359 0.14
360 0.15
361 0.19
362 0.19
363 0.2
364 0.21
365 0.23
366 0.2
367 0.2
368 0.2
369 0.16
370 0.15
371 0.14
372 0.14
373 0.1
374 0.1
375 0.08
376 0.07
377 0.08
378 0.08
379 0.08
380 0.08
381 0.06
382 0.06
383 0.06
384 0.07
385 0.08
386 0.07
387 0.07
388 0.06
389 0.06
390 0.06
391 0.07
392 0.06
393 0.05
394 0.07
395 0.07
396 0.14
397 0.15
398 0.18
399 0.21
400 0.23
401 0.24
402 0.22
403 0.25
404 0.22
405 0.22
406 0.25
407 0.22
408 0.2
409 0.19
410 0.19
411 0.18
412 0.15
413 0.15
414 0.11
415 0.12
416 0.14
417 0.13
418 0.14
419 0.13
420 0.13
421 0.12
422 0.1
423 0.08
424 0.07
425 0.07
426 0.07
427 0.07
428 0.09
429 0.1
430 0.1
431 0.1
432 0.12
433 0.16
434 0.24
435 0.29
436 0.31
437 0.32
438 0.33
439 0.34
440 0.32
441 0.28
442 0.2
443 0.15
444 0.11
445 0.11
446 0.09
447 0.09
448 0.1
449 0.1
450 0.11
451 0.14
452 0.21
453 0.26
454 0.31
455 0.39
456 0.47
457 0.55
458 0.59
459 0.57
460 0.55
461 0.5
462 0.48
463 0.46
464 0.45
465 0.4
466 0.42
467 0.43
468 0.39
469 0.39
470 0.38
471 0.38
472 0.41
473 0.46
474 0.46
475 0.5
476 0.56
477 0.57
478 0.61
479 0.6
480 0.53
481 0.51
482 0.49
483 0.43
484 0.42
485 0.39
486 0.34
487 0.33
488 0.32
489 0.31
490 0.29
491 0.29
492 0.24
493 0.26
494 0.3
495 0.29
496 0.31
497 0.31
498 0.34
499 0.33
500 0.32
501 0.29
502 0.26
503 0.23
504 0.19
505 0.15
506 0.14
507 0.19
508 0.27
509 0.33
510 0.38
511 0.4
512 0.44
513 0.48
514 0.5
515 0.51
516 0.49
517 0.53
518 0.52
519 0.56
520 0.58
521 0.62
522 0.65
523 0.63
524 0.63
525 0.63
526 0.62
527 0.6
528 0.6
529 0.6
530 0.58
531 0.61
532 0.61
533 0.61
534 0.66
535 0.66
536 0.6
537 0.58
538 0.58
539 0.55
540 0.54
541 0.54
542 0.56
543 0.59
544 0.62
545 0.59
546 0.6
547 0.66
548 0.72
549 0.72
550 0.73
551 0.74
552 0.81
553 0.82
554 0.84
555 0.82
556 0.76
557 0.74
558 0.74
559 0.75
560 0.75
561 0.75
562 0.72