Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Y8I1

Protein Details
Accession A0A4Y9Y8I1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-106HTQTAHARCKWRRRWVANGEGESHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, cyto 6, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MSKVLDVDEVGRKPVEAAAAAEGFAFVLKSVAAVPVVLEVVPVLAVLWVGFGEYVGGEGSKEDVLSADELEISCYELASASAVHTQTAHARCKWRRRWVANGEGESALFNADAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.11
4 0.12
5 0.13
6 0.13
7 0.13
8 0.12
9 0.1
10 0.09
11 0.08
12 0.06
13 0.03
14 0.03
15 0.03
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.05
52 0.05
53 0.05
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.08
69 0.08
70 0.08
71 0.08
72 0.1
73 0.16
74 0.21
75 0.25
76 0.26
77 0.36
78 0.44
79 0.54
80 0.63
81 0.67
82 0.73
83 0.75
84 0.81
85 0.81
86 0.83
87 0.81
88 0.74
89 0.66
90 0.56
91 0.49
92 0.39
93 0.3
94 0.21