Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YCQ7

Protein Details
Accession A0A4Y9YCQ7    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
159-185SRRGGSCTSRRPPRRTSRRSSRTQFALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 5.5, cyto_nucl 5.5, nucl 4.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036108  4pyrrol_syn_uPrphyn_synt_sf  
IPR003754  4pyrrol_synth_uPrphyn_synth  
IPR039793  UROS/Hem4  
Gene Ontology GO:0004852  F:uroporphyrinogen-III synthase activity  
GO:0006782  P:protoporphyrinogen IX biosynthetic process  
GO:0006780  P:uroporphyrinogen III biosynthetic process  
Pfam View protein in Pfam  
PF02602  HEM4  
Amino Acid Sequences MAPVLLLRAPTPPDRYESALSRAGFTPVSVPVLETAFVNAEELRALVRAGPGAAGMQGVVVTSAGGRGMKSCRQTSPFYAIGPSTASCLASIASHAQRLCPSDIRGGAETGTAGLLAHFILRDAGAAPSARLLYLTDDKNRETLPALLDAGGVALRALSRRGGSCTSRRPPRRTSRRSSRTQFALPGAGDPYAQGGRRAHFAAIRPTTAEDLVQELGLRVEVVPAKPSAEALVDALEESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.38
4 0.38
5 0.39
6 0.4
7 0.39
8 0.37
9 0.34
10 0.31
11 0.26
12 0.22
13 0.19
14 0.15
15 0.16
16 0.13
17 0.13
18 0.12
19 0.13
20 0.13
21 0.11
22 0.1
23 0.09
24 0.09
25 0.1
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.07
55 0.11
56 0.16
57 0.21
58 0.23
59 0.27
60 0.31
61 0.35
62 0.36
63 0.39
64 0.36
65 0.31
66 0.3
67 0.25
68 0.22
69 0.19
70 0.16
71 0.11
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.06
78 0.07
79 0.09
80 0.1
81 0.12
82 0.12
83 0.13
84 0.14
85 0.17
86 0.18
87 0.17
88 0.17
89 0.18
90 0.19
91 0.2
92 0.19
93 0.17
94 0.15
95 0.13
96 0.11
97 0.08
98 0.06
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.05
118 0.05
119 0.05
120 0.08
121 0.12
122 0.15
123 0.18
124 0.2
125 0.2
126 0.22
127 0.21
128 0.19
129 0.16
130 0.15
131 0.13
132 0.12
133 0.12
134 0.11
135 0.1
136 0.09
137 0.08
138 0.06
139 0.05
140 0.03
141 0.03
142 0.03
143 0.04
144 0.05
145 0.06
146 0.07
147 0.08
148 0.12
149 0.16
150 0.2
151 0.27
152 0.36
153 0.43
154 0.53
155 0.6
156 0.63
157 0.69
158 0.76
159 0.8
160 0.8
161 0.82
162 0.83
163 0.83
164 0.87
165 0.84
166 0.81
167 0.76
168 0.7
169 0.63
170 0.54
171 0.48
172 0.38
173 0.33
174 0.26
175 0.2
176 0.16
177 0.13
178 0.14
179 0.13
180 0.13
181 0.16
182 0.17
183 0.18
184 0.22
185 0.23
186 0.22
187 0.22
188 0.25
189 0.31
190 0.32
191 0.31
192 0.29
193 0.3
194 0.3
195 0.27
196 0.24
197 0.15
198 0.15
199 0.14
200 0.13
201 0.11
202 0.1
203 0.09
204 0.09
205 0.09
206 0.06
207 0.09
208 0.12
209 0.13
210 0.15
211 0.15
212 0.16
213 0.16
214 0.17
215 0.14
216 0.13
217 0.13
218 0.11
219 0.12
220 0.1