Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XM13

Protein Details
Accession A0A4Y9XM13   
Localization Confidence High
Confidence Score 21.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-60GAPAQHKQTSRKGKKAWRKNVDLEDMEHydrophilic
298-326EVVKPKMPVRKTKQQRRKAEKLRAEKRALBasic
424-448LIEPRVPVLPKKRRAQTKEVEKYAWHydrophilic
NLS Segment(s)
PositionSequence
42-51TSRKGKKAWR
151-155GKKAR
301-334KPKMPVRKTKQQRRKAEKLRAEKRALVERALRKR
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MAVTKAKSASTSGTTTTKLSKDSKKPKAATSVVGAPAQHKQTSRKGKKAWRKNVDLEDMEETLEDIRGEERLFGTALHHKKDEDLFMVDSKGDEKLRKALPKFSTSRLTSHKILAQRSAIPAVVSRPTSSGKKRSAAHVSSTDKDRLLRIGKKARRGPLNSIVDHDQFGEGSAVMEVSEAVKLSGKYDVWSGEVEVEGVKVKAPNVPHPRNAIAIPAIATPHAGASYNPDVAAHTELLRTAHELEEQRLKESMKGQDVKERVLAARRTEADIASGGVDGMLIDKPGEGVEEEDEAGEEVVKPKMPVRKTKQQRRKAEKLRAEKRALVERALRKRLLASVDTVKTLRKSTDATLAARAQAIAERRARVQEQLQKGLAGQRLGKHRVQEGEVDVQLGEDLSESLRGLRPEGNLFRDRFVSMQQRALIEPRVPVLPKKRRAQTKEVEKYAWKRFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.34
4 0.32
5 0.34
6 0.39
7 0.45
8 0.53
9 0.62
10 0.7
11 0.74
12 0.76
13 0.77
14 0.79
15 0.72
16 0.66
17 0.6
18 0.57
19 0.5
20 0.47
21 0.41
22 0.33
23 0.36
24 0.35
25 0.33
26 0.3
27 0.34
28 0.42
29 0.53
30 0.61
31 0.64
32 0.7
33 0.77
34 0.84
35 0.89
36 0.9
37 0.88
38 0.87
39 0.86
40 0.85
41 0.82
42 0.73
43 0.65
44 0.58
45 0.48
46 0.39
47 0.3
48 0.22
49 0.15
50 0.14
51 0.1
52 0.07
53 0.07
54 0.08
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.13
62 0.21
63 0.26
64 0.28
65 0.29
66 0.28
67 0.31
68 0.34
69 0.33
70 0.27
71 0.25
72 0.23
73 0.23
74 0.24
75 0.2
76 0.17
77 0.15
78 0.16
79 0.16
80 0.16
81 0.18
82 0.24
83 0.31
84 0.39
85 0.4
86 0.45
87 0.47
88 0.54
89 0.55
90 0.53
91 0.55
92 0.49
93 0.53
94 0.51
95 0.51
96 0.45
97 0.45
98 0.44
99 0.41
100 0.41
101 0.39
102 0.35
103 0.32
104 0.32
105 0.3
106 0.26
107 0.2
108 0.19
109 0.17
110 0.18
111 0.16
112 0.15
113 0.16
114 0.19
115 0.26
116 0.31
117 0.37
118 0.39
119 0.45
120 0.46
121 0.51
122 0.56
123 0.52
124 0.5
125 0.5
126 0.49
127 0.46
128 0.48
129 0.43
130 0.35
131 0.34
132 0.3
133 0.27
134 0.29
135 0.31
136 0.36
137 0.44
138 0.48
139 0.56
140 0.61
141 0.63
142 0.64
143 0.63
144 0.62
145 0.62
146 0.63
147 0.54
148 0.51
149 0.48
150 0.4
151 0.36
152 0.29
153 0.19
154 0.13
155 0.13
156 0.1
157 0.06
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.06
169 0.06
170 0.07
171 0.09
172 0.09
173 0.09
174 0.11
175 0.11
176 0.1
177 0.11
178 0.1
179 0.08
180 0.08
181 0.07
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.08
190 0.1
191 0.19
192 0.29
193 0.32
194 0.35
195 0.37
196 0.38
197 0.37
198 0.36
199 0.28
200 0.19
201 0.15
202 0.13
203 0.1
204 0.09
205 0.07
206 0.07
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.09
213 0.1
214 0.11
215 0.1
216 0.1
217 0.1
218 0.11
219 0.13
220 0.08
221 0.07
222 0.07
223 0.08
224 0.08
225 0.08
226 0.08
227 0.07
228 0.07
229 0.1
230 0.11
231 0.13
232 0.19
233 0.19
234 0.2
235 0.21
236 0.21
237 0.19
238 0.23
239 0.25
240 0.26
241 0.29
242 0.29
243 0.34
244 0.34
245 0.33
246 0.3
247 0.27
248 0.21
249 0.24
250 0.25
251 0.21
252 0.24
253 0.24
254 0.24
255 0.24
256 0.23
257 0.17
258 0.15
259 0.14
260 0.09
261 0.08
262 0.06
263 0.05
264 0.05
265 0.03
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.04
275 0.05
276 0.06
277 0.06
278 0.07
279 0.06
280 0.06
281 0.06
282 0.06
283 0.05
284 0.05
285 0.06
286 0.07
287 0.07
288 0.08
289 0.12
290 0.18
291 0.23
292 0.33
293 0.4
294 0.5
295 0.6
296 0.71
297 0.78
298 0.82
299 0.88
300 0.88
301 0.91
302 0.9
303 0.9
304 0.88
305 0.88
306 0.87
307 0.85
308 0.79
309 0.72
310 0.67
311 0.65
312 0.57
313 0.5
314 0.49
315 0.49
316 0.54
317 0.55
318 0.51
319 0.42
320 0.42
321 0.42
322 0.38
323 0.31
324 0.26
325 0.28
326 0.29
327 0.3
328 0.29
329 0.28
330 0.26
331 0.27
332 0.23
333 0.19
334 0.2
335 0.21
336 0.29
337 0.3
338 0.3
339 0.33
340 0.33
341 0.31
342 0.28
343 0.26
344 0.17
345 0.17
346 0.18
347 0.19
348 0.21
349 0.23
350 0.24
351 0.29
352 0.3
353 0.31
354 0.36
355 0.39
356 0.42
357 0.46
358 0.45
359 0.41
360 0.41
361 0.42
362 0.37
363 0.31
364 0.27
365 0.27
366 0.34
367 0.39
368 0.4
369 0.38
370 0.4
371 0.41
372 0.4
373 0.39
374 0.35
375 0.35
376 0.33
377 0.3
378 0.25
379 0.2
380 0.18
381 0.14
382 0.1
383 0.05
384 0.05
385 0.05
386 0.06
387 0.06
388 0.08
389 0.12
390 0.12
391 0.14
392 0.18
393 0.2
394 0.27
395 0.33
396 0.37
397 0.41
398 0.42
399 0.42
400 0.41
401 0.39
402 0.32
403 0.34
404 0.37
405 0.34
406 0.38
407 0.39
408 0.38
409 0.39
410 0.41
411 0.38
412 0.31
413 0.29
414 0.26
415 0.28
416 0.28
417 0.34
418 0.41
419 0.47
420 0.54
421 0.62
422 0.7
423 0.75
424 0.81
425 0.84
426 0.84
427 0.85
428 0.86
429 0.82
430 0.78
431 0.76
432 0.76