Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZFN8

Protein Details
Accession A0A4Y9ZFN8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79GSSFRRRNRARVRQLGSRTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 10
Family & Domain DBs
Amino Acid Sequences MNKYLSWVGGGACLLLDADGERCFLRTALSLKKVRSCCIWRMGIVAATAVPMRVKSVAVGSSFRRRNRARVRQLGSRTLVLEPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.06
6 0.06
7 0.07
8 0.07
9 0.08
10 0.09
11 0.09
12 0.09
13 0.11
14 0.15
15 0.2
16 0.28
17 0.31
18 0.32
19 0.4
20 0.4
21 0.38
22 0.41
23 0.38
24 0.35
25 0.37
26 0.36
27 0.29
28 0.29
29 0.28
30 0.22
31 0.18
32 0.14
33 0.08
34 0.07
35 0.07
36 0.06
37 0.05
38 0.04
39 0.05
40 0.06
41 0.06
42 0.06
43 0.08
44 0.1
45 0.11
46 0.14
47 0.17
48 0.26
49 0.33
50 0.35
51 0.43
52 0.44
53 0.53
54 0.61
55 0.68
56 0.7
57 0.74
58 0.77
59 0.78
60 0.81
61 0.77
62 0.7
63 0.61
64 0.53