Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YXE4

Protein Details
Accession A0A4Y9YXE4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-32SDFARKTPSPPHQPPPHQPPPHHydrophilic
NLS Segment(s)
PositionSequence
35-51PPPPPQPPPPPPQPPPP
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, mito 7, extr 4
Family & Domain DBs
Amino Acid Sequences MRNECSKGLLSDFARKTPSPPHQPPPHQPPPHPPPPPPPQPPPPPPQPPPPPPPHPAPLPPQPPPPPPAAPPAPQAAPELYAPASACIQVSAEIELTAPHPYALPRPCGACTHPLALPPRLVAHVCTCAITPPLHCRTVPGIGTLAPIRALCAIVPIPRCPCSCAVMRSSWHPSAVLPAAPPPLRPASAPYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.38
4 0.41
5 0.48
6 0.49
7 0.54
8 0.61
9 0.67
10 0.75
11 0.81
12 0.81
13 0.82
14 0.78
15 0.74
16 0.74
17 0.73
18 0.74
19 0.7
20 0.64
21 0.62
22 0.65
23 0.71
24 0.67
25 0.66
26 0.65
27 0.7
28 0.73
29 0.71
30 0.71
31 0.7
32 0.68
33 0.7
34 0.7
35 0.68
36 0.7
37 0.71
38 0.67
39 0.63
40 0.64
41 0.59
42 0.53
43 0.5
44 0.48
45 0.49
46 0.49
47 0.48
48 0.5
49 0.5
50 0.49
51 0.47
52 0.46
53 0.39
54 0.35
55 0.38
56 0.34
57 0.32
58 0.31
59 0.31
60 0.27
61 0.25
62 0.24
63 0.18
64 0.16
65 0.13
66 0.12
67 0.09
68 0.1
69 0.09
70 0.08
71 0.08
72 0.07
73 0.06
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.06
89 0.11
90 0.13
91 0.15
92 0.15
93 0.17
94 0.18
95 0.19
96 0.21
97 0.19
98 0.19
99 0.19
100 0.19
101 0.22
102 0.24
103 0.23
104 0.22
105 0.18
106 0.17
107 0.17
108 0.16
109 0.14
110 0.13
111 0.14
112 0.14
113 0.14
114 0.13
115 0.13
116 0.14
117 0.14
118 0.13
119 0.18
120 0.22
121 0.23
122 0.23
123 0.25
124 0.27
125 0.31
126 0.3
127 0.23
128 0.2
129 0.19
130 0.21
131 0.19
132 0.15
133 0.11
134 0.1
135 0.1
136 0.09
137 0.09
138 0.07
139 0.09
140 0.11
141 0.14
142 0.17
143 0.19
144 0.23
145 0.27
146 0.28
147 0.28
148 0.28
149 0.28
150 0.31
151 0.32
152 0.32
153 0.33
154 0.35
155 0.39
156 0.44
157 0.42
158 0.38
159 0.34
160 0.3
161 0.31
162 0.31
163 0.25
164 0.19
165 0.2
166 0.26
167 0.26
168 0.26
169 0.25
170 0.27
171 0.27
172 0.27