Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Y712

Protein Details
Accession A0A4Y9Y712    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-31KRRAEEPELKTKKRKKAKVEDEDDFDBasic
104-129SSSSKAKEPAKPPPKKKKAVQEESEEHydrophilic
NLS Segment(s)
PositionSequence
4-23KSKRRAEEPELKTKKRKKAK
86-121KPKKKAKPASKGKASSKPSSSSKAKEPAKPPPKKKK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSSKSKRRAEEPELKTKKRKKAKVEDEDDFDEEDSDAGVDEDELGGLDTSNIITGGRRTRGIRIDYTKVAPIPGDDDDDEDEEEEKPKKKAKPASKGKASSKPSSSSKAKEPAKPPPKKKKAVQEESEEEEEKEEDEDDKGDTKHGGDEDEEEEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.79
4 0.8
5 0.8
6 0.82
7 0.81
8 0.83
9 0.88
10 0.89
11 0.88
12 0.83
13 0.78
14 0.73
15 0.63
16 0.52
17 0.41
18 0.31
19 0.22
20 0.17
21 0.11
22 0.07
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.03
40 0.04
41 0.07
42 0.11
43 0.13
44 0.16
45 0.17
46 0.22
47 0.27
48 0.3
49 0.33
50 0.34
51 0.36
52 0.36
53 0.36
54 0.33
55 0.28
56 0.25
57 0.19
58 0.14
59 0.12
60 0.1
61 0.1
62 0.09
63 0.1
64 0.1
65 0.11
66 0.1
67 0.08
68 0.08
69 0.07
70 0.09
71 0.11
72 0.12
73 0.14
74 0.2
75 0.23
76 0.3
77 0.39
78 0.47
79 0.55
80 0.64
81 0.72
82 0.75
83 0.78
84 0.78
85 0.78
86 0.73
87 0.68
88 0.6
89 0.56
90 0.51
91 0.51
92 0.5
93 0.44
94 0.45
95 0.49
96 0.51
97 0.53
98 0.54
99 0.58
100 0.64
101 0.7
102 0.74
103 0.76
104 0.81
105 0.82
106 0.84
107 0.84
108 0.85
109 0.85
110 0.8
111 0.77
112 0.73
113 0.7
114 0.67
115 0.57
116 0.45
117 0.37
118 0.31
119 0.23
120 0.18
121 0.13
122 0.1
123 0.1
124 0.1
125 0.1
126 0.14
127 0.13
128 0.14
129 0.14
130 0.14
131 0.17
132 0.18
133 0.18
134 0.16
135 0.18
136 0.19
137 0.21