Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YL03

Protein Details
Accession A0A4Y9YL03    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-85ASQPERTPKPKIKPNRNRKNIRLEAHydrophilic
NLS Segment(s)
PositionSequence
67-81TPKPKIKPNRNRKNI
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MSDVQRRGGALWGSRQFGPDSTEPFDAAEPEPEPEPEPPRGFQPQPEAGVLASEQRSSHAASQPERTPKPKIKPNRNRKNIRLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.29
4 0.27
5 0.29
6 0.23
7 0.23
8 0.24
9 0.24
10 0.23
11 0.22
12 0.21
13 0.18
14 0.16
15 0.14
16 0.11
17 0.11
18 0.12
19 0.12
20 0.13
21 0.13
22 0.16
23 0.18
24 0.19
25 0.19
26 0.21
27 0.25
28 0.24
29 0.24
30 0.27
31 0.26
32 0.26
33 0.25
34 0.22
35 0.17
36 0.17
37 0.15
38 0.12
39 0.09
40 0.08
41 0.08
42 0.09
43 0.1
44 0.12
45 0.15
46 0.18
47 0.21
48 0.24
49 0.29
50 0.34
51 0.42
52 0.44
53 0.45
54 0.48
55 0.53
56 0.61
57 0.65
58 0.7
59 0.72
60 0.79
61 0.87
62 0.9
63 0.92
64 0.92
65 0.91