Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YTW6

Protein Details
Accession A0A4Y9YTW6   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
345-374KQSTRSRAAKPPRKSPKKRGAPRSSRRAPVBasic
NLS Segment(s)
PositionSequence
349-373TRSRAAKPPRKSPKKRGAPRSSRRA
Subcellular Location(s) plas 19, E.R. 3, mito 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002293  AA/rel_permease1  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF13520  AA_permease_2  
Amino Acid Sequences MGPPDKRNISTCTQGLPGAPARARFKDAVYHPRRPAIPEAQEALTRAPAATSTSTLSFSHTSSLSSASTRTRSISAMTSLEKPQPQPPAIAPVDRDPESHHPNPNHERDKDIEDSDARLHALGYAPTFRREMSLFGVLGISFCAIGILTGMSSAFQTGLFSGGPLGLFWGWNRWLVVRELNLRACVRTGRQICSFFMLLIALCLAEICXAYPTMGGLYFWVCKMKPDLPVLGFCTGWIYAIAMTFTGTSGNLSVALYIASLAEVGQGRTLTRVETAAIAWGVNILSGALNTVGTKAIGHMSAFNMWWTLGGTLVLVVTLLVKAPEKVRVSPAGARAASSSSSASSKQSTRSRAAKPPRKSPKKRGAPRSSRRAPVSPDLGGVRAFHLPLRASLELPLPPTPEYQSPGPGVYGFGFGQPPAAVREEEEEEVTLRHGSTLPWEVRRGVVEGDEEEGDGDGDGESVIKEELEYNEGRRASIFKRFSRQSMRPSPRSVLYPAIWRIVTFQIAFLLTIALAALSTLIDLIRNRPPTAFGTQHVALVLAAWGPGIVFGPCSSQATSRACAGACICSDSIRRFVAQPSRARSLTYLPARPPLGTDTRSAWRAGSSTMLDTNTDTDAHAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.33
4 0.32
5 0.31
6 0.31
7 0.35
8 0.39
9 0.41
10 0.45
11 0.41
12 0.39
13 0.41
14 0.46
15 0.51
16 0.53
17 0.59
18 0.58
19 0.63
20 0.63
21 0.59
22 0.59
23 0.57
24 0.55
25 0.51
26 0.51
27 0.46
28 0.46
29 0.43
30 0.37
31 0.29
32 0.23
33 0.18
34 0.14
35 0.12
36 0.14
37 0.14
38 0.14
39 0.15
40 0.16
41 0.19
42 0.18
43 0.22
44 0.2
45 0.19
46 0.21
47 0.18
48 0.18
49 0.17
50 0.19
51 0.17
52 0.16
53 0.18
54 0.2
55 0.23
56 0.23
57 0.25
58 0.24
59 0.24
60 0.25
61 0.26
62 0.25
63 0.25
64 0.26
65 0.28
66 0.29
67 0.34
68 0.34
69 0.33
70 0.35
71 0.4
72 0.38
73 0.37
74 0.36
75 0.39
76 0.38
77 0.38
78 0.34
79 0.32
80 0.37
81 0.34
82 0.33
83 0.3
84 0.36
85 0.42
86 0.45
87 0.47
88 0.45
89 0.54
90 0.62
91 0.66
92 0.66
93 0.59
94 0.58
95 0.53
96 0.56
97 0.51
98 0.43
99 0.37
100 0.3
101 0.31
102 0.28
103 0.26
104 0.2
105 0.16
106 0.14
107 0.12
108 0.12
109 0.11
110 0.11
111 0.16
112 0.17
113 0.19
114 0.2
115 0.19
116 0.2
117 0.2
118 0.2
119 0.19
120 0.21
121 0.19
122 0.19
123 0.19
124 0.16
125 0.15
126 0.13
127 0.09
128 0.05
129 0.04
130 0.04
131 0.03
132 0.03
133 0.04
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.07
153 0.06
154 0.06
155 0.06
156 0.1
157 0.11
158 0.12
159 0.13
160 0.12
161 0.14
162 0.16
163 0.19
164 0.19
165 0.24
166 0.27
167 0.27
168 0.3
169 0.29
170 0.28
171 0.26
172 0.24
173 0.21
174 0.26
175 0.28
176 0.28
177 0.33
178 0.35
179 0.34
180 0.36
181 0.34
182 0.25
183 0.22
184 0.17
185 0.11
186 0.09
187 0.08
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.05
203 0.06
204 0.07
205 0.07
206 0.1
207 0.09
208 0.11
209 0.15
210 0.18
211 0.21
212 0.23
213 0.26
214 0.25
215 0.27
216 0.28
217 0.25
218 0.22
219 0.17
220 0.16
221 0.12
222 0.11
223 0.09
224 0.07
225 0.06
226 0.06
227 0.06
228 0.04
229 0.05
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.04
241 0.04
242 0.04
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.04
249 0.05
250 0.05
251 0.06
252 0.06
253 0.06
254 0.08
255 0.08
256 0.07
257 0.07
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.07
264 0.06
265 0.05
266 0.05
267 0.05
268 0.04
269 0.04
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.03
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.05
283 0.05
284 0.06
285 0.06
286 0.06
287 0.07
288 0.07
289 0.07
290 0.06
291 0.06
292 0.06
293 0.06
294 0.05
295 0.04
296 0.04
297 0.04
298 0.03
299 0.03
300 0.03
301 0.02
302 0.02
303 0.02
304 0.02
305 0.03
306 0.03
307 0.03
308 0.04
309 0.05
310 0.11
311 0.13
312 0.14
313 0.16
314 0.18
315 0.2
316 0.23
317 0.25
318 0.24
319 0.22
320 0.22
321 0.2
322 0.19
323 0.17
324 0.14
325 0.12
326 0.08
327 0.09
328 0.1
329 0.11
330 0.13
331 0.14
332 0.2
333 0.26
334 0.29
335 0.34
336 0.41
337 0.45
338 0.51
339 0.61
340 0.63
341 0.63
342 0.69
343 0.75
344 0.79
345 0.82
346 0.83
347 0.83
348 0.85
349 0.89
350 0.89
351 0.89
352 0.89
353 0.89
354 0.89
355 0.85
356 0.8
357 0.74
358 0.67
359 0.61
360 0.55
361 0.5
362 0.39
363 0.35
364 0.29
365 0.25
366 0.22
367 0.18
368 0.14
369 0.11
370 0.1
371 0.09
372 0.11
373 0.1
374 0.11
375 0.16
376 0.15
377 0.14
378 0.15
379 0.17
380 0.16
381 0.18
382 0.17
383 0.14
384 0.14
385 0.15
386 0.16
387 0.16
388 0.18
389 0.17
390 0.19
391 0.18
392 0.18
393 0.17
394 0.15
395 0.14
396 0.12
397 0.13
398 0.1
399 0.1
400 0.1
401 0.09
402 0.1
403 0.09
404 0.09
405 0.09
406 0.1
407 0.09
408 0.09
409 0.13
410 0.14
411 0.15
412 0.15
413 0.13
414 0.12
415 0.12
416 0.13
417 0.1
418 0.07
419 0.07
420 0.07
421 0.07
422 0.1
423 0.17
424 0.2
425 0.22
426 0.24
427 0.24
428 0.24
429 0.25
430 0.23
431 0.17
432 0.15
433 0.13
434 0.12
435 0.14
436 0.12
437 0.11
438 0.09
439 0.09
440 0.07
441 0.06
442 0.06
443 0.04
444 0.04
445 0.04
446 0.04
447 0.04
448 0.04
449 0.04
450 0.04
451 0.04
452 0.06
453 0.07
454 0.1
455 0.11
456 0.13
457 0.18
458 0.19
459 0.18
460 0.18
461 0.21
462 0.2
463 0.29
464 0.35
465 0.34
466 0.43
467 0.46
468 0.52
469 0.58
470 0.62
471 0.62
472 0.66
473 0.7
474 0.67
475 0.69
476 0.66
477 0.6
478 0.56
479 0.5
480 0.44
481 0.37
482 0.38
483 0.35
484 0.35
485 0.32
486 0.28
487 0.28
488 0.25
489 0.25
490 0.18
491 0.16
492 0.14
493 0.15
494 0.15
495 0.12
496 0.1
497 0.07
498 0.06
499 0.06
500 0.04
501 0.03
502 0.03
503 0.03
504 0.02
505 0.03
506 0.03
507 0.03
508 0.06
509 0.07
510 0.11
511 0.18
512 0.21
513 0.22
514 0.23
515 0.26
516 0.28
517 0.35
518 0.34
519 0.29
520 0.33
521 0.32
522 0.32
523 0.29
524 0.25
525 0.18
526 0.15
527 0.14
528 0.07
529 0.06
530 0.05
531 0.04
532 0.04
533 0.04
534 0.05
535 0.04
536 0.05
537 0.06
538 0.09
539 0.1
540 0.13
541 0.14
542 0.16
543 0.23
544 0.26
545 0.28
546 0.27
547 0.28
548 0.25
549 0.26
550 0.25
551 0.23
552 0.19
553 0.21
554 0.19
555 0.21
556 0.25
557 0.26
558 0.29
559 0.27
560 0.28
561 0.26
562 0.33
563 0.4
564 0.43
565 0.48
566 0.5
567 0.56
568 0.54
569 0.54
570 0.49
571 0.45
572 0.47
573 0.47
574 0.46
575 0.42
576 0.49
577 0.48
578 0.46
579 0.42
580 0.39
581 0.38
582 0.34
583 0.34
584 0.33
585 0.38
586 0.39
587 0.38
588 0.32
589 0.27
590 0.27
591 0.25
592 0.25
593 0.2
594 0.22
595 0.24
596 0.24
597 0.23
598 0.23
599 0.23
600 0.2
601 0.18