Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YVZ0

Protein Details
Accession A0A4Y9YVZ0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-53GRKGEEIRGRTRRRKTKKREIEKEKDDDGBasic
NLS Segment(s)
PositionSequence
26-50RKGEEIRGRTRRRKTKKREIEKEKD
56-57AR
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MPLGHPWPVGYGYGCASGTEAGQTGRKGEEIRGRTRRRKTKKREIEKEKDDDGYRARRDTKIGIGIKARTKSIDQSIEAGKRTRETETGKEKMETKQTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.12
5 0.11
6 0.1
7 0.1
8 0.08
9 0.11
10 0.11
11 0.12
12 0.12
13 0.13
14 0.14
15 0.17
16 0.24
17 0.26
18 0.36
19 0.44
20 0.52
21 0.59
22 0.68
23 0.75
24 0.78
25 0.84
26 0.85
27 0.86
28 0.89
29 0.91
30 0.92
31 0.92
32 0.91
33 0.86
34 0.81
35 0.71
36 0.63
37 0.53
38 0.44
39 0.37
40 0.34
41 0.29
42 0.27
43 0.28
44 0.26
45 0.28
46 0.28
47 0.28
48 0.29
49 0.29
50 0.29
51 0.3
52 0.33
53 0.36
54 0.35
55 0.32
56 0.26
57 0.26
58 0.27
59 0.3
60 0.31
61 0.27
62 0.28
63 0.33
64 0.35
65 0.36
66 0.34
67 0.29
68 0.27
69 0.28
70 0.28
71 0.29
72 0.31
73 0.38
74 0.45
75 0.49
76 0.48
77 0.5
78 0.5
79 0.5