Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Z098

Protein Details
Accession A0A4Y9Z098    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MALSTPKTHAHKWRRRRGWRIRGAEQPKGAHydrophilic
NLS Segment(s)
PositionSequence
10-24AHKWRRRRGWRIRGA
Subcellular Location(s) mito 12, nucl 7, cyto 4, plas 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MALSTPKTHAHKWRRRRGWRIRGAEQPKGAIVGKFFILVPHAPSLPSHAPSLPSRVPSLPSLMPAALNLAPTVLAHPRATLSHHCMALFHPLMPTALAHPHAASSPSDSTGCALHAVSPPCVPSHHPTCHLAAPPAMLPPHAPCRCHVRRVVPPCALATVQAACCMLPNCRVAALHAVSCHVHPSNGAGYALRALAAISCPMISVANLSHPLSCPGHHCVPRNALPRTRAILLYPGCHLAPRGTVSCHLAPQCHRLDPPMPSRAPTLPFRAPAVLSRSPWGRLVPQCHRSTPQHCLETPLHRLDPCSTISDTHGXISRPNATVLTAAVPSRTPVVPSRAPAPPSRICTPLGHICTGLLHCSAAILCPSDAVSAVLCPQRCHPALAPHPPALVLHRRCLLHFALHGCCLMPQCSHLGCFMPHSHHLVPLWHCCKPMAQPRAPAPSSLPSHAPSTTPFAVLHSTVAILCLSATLSILSCPPATVSHPPSTVLCPHSAVSLTHSMISCLHRALWPVPCSCTATALCAAATLSCAHTTLLHRCHRLTPQHCCHKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.9
3 0.94
4 0.94
5 0.94
6 0.94
7 0.92
8 0.88
9 0.88
10 0.84
11 0.81
12 0.73
13 0.63
14 0.53
15 0.48
16 0.42
17 0.33
18 0.27
19 0.21
20 0.19
21 0.18
22 0.17
23 0.14
24 0.15
25 0.15
26 0.17
27 0.18
28 0.18
29 0.17
30 0.18
31 0.25
32 0.26
33 0.27
34 0.26
35 0.24
36 0.28
37 0.3
38 0.37
39 0.33
40 0.31
41 0.33
42 0.32
43 0.34
44 0.31
45 0.35
46 0.28
47 0.26
48 0.26
49 0.23
50 0.21
51 0.18
52 0.2
53 0.15
54 0.14
55 0.12
56 0.1
57 0.09
58 0.09
59 0.12
60 0.11
61 0.13
62 0.13
63 0.14
64 0.15
65 0.16
66 0.21
67 0.25
68 0.29
69 0.31
70 0.32
71 0.31
72 0.3
73 0.3
74 0.35
75 0.3
76 0.23
77 0.19
78 0.18
79 0.18
80 0.18
81 0.17
82 0.11
83 0.13
84 0.13
85 0.14
86 0.13
87 0.14
88 0.14
89 0.15
90 0.14
91 0.15
92 0.15
93 0.16
94 0.17
95 0.16
96 0.16
97 0.15
98 0.15
99 0.12
100 0.1
101 0.11
102 0.16
103 0.18
104 0.18
105 0.19
106 0.19
107 0.18
108 0.2
109 0.2
110 0.22
111 0.29
112 0.32
113 0.35
114 0.37
115 0.39
116 0.42
117 0.41
118 0.35
119 0.28
120 0.25
121 0.22
122 0.21
123 0.18
124 0.14
125 0.13
126 0.15
127 0.25
128 0.26
129 0.26
130 0.26
131 0.36
132 0.41
133 0.46
134 0.48
135 0.46
136 0.52
137 0.59
138 0.65
139 0.58
140 0.54
141 0.49
142 0.45
143 0.37
144 0.28
145 0.22
146 0.17
147 0.14
148 0.13
149 0.13
150 0.1
151 0.12
152 0.12
153 0.12
154 0.13
155 0.14
156 0.13
157 0.14
158 0.14
159 0.14
160 0.19
161 0.19
162 0.16
163 0.16
164 0.17
165 0.16
166 0.16
167 0.18
168 0.12
169 0.11
170 0.1
171 0.12
172 0.12
173 0.13
174 0.13
175 0.1
176 0.1
177 0.11
178 0.11
179 0.08
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.04
191 0.05
192 0.05
193 0.07
194 0.09
195 0.1
196 0.1
197 0.1
198 0.14
199 0.14
200 0.14
201 0.15
202 0.19
203 0.25
204 0.29
205 0.32
206 0.33
207 0.38
208 0.44
209 0.49
210 0.47
211 0.44
212 0.42
213 0.42
214 0.41
215 0.37
216 0.3
217 0.23
218 0.26
219 0.22
220 0.22
221 0.19
222 0.17
223 0.15
224 0.15
225 0.15
226 0.09
227 0.1
228 0.11
229 0.11
230 0.11
231 0.12
232 0.16
233 0.16
234 0.18
235 0.18
236 0.18
237 0.18
238 0.24
239 0.25
240 0.23
241 0.22
242 0.22
243 0.24
244 0.27
245 0.3
246 0.3
247 0.28
248 0.28
249 0.3
250 0.3
251 0.3
252 0.28
253 0.28
254 0.24
255 0.25
256 0.24
257 0.23
258 0.21
259 0.2
260 0.24
261 0.2
262 0.19
263 0.2
264 0.2
265 0.2
266 0.21
267 0.19
268 0.18
269 0.19
270 0.26
271 0.31
272 0.38
273 0.39
274 0.39
275 0.43
276 0.43
277 0.44
278 0.44
279 0.43
280 0.38
281 0.37
282 0.4
283 0.39
284 0.39
285 0.39
286 0.35
287 0.3
288 0.26
289 0.28
290 0.24
291 0.23
292 0.2
293 0.19
294 0.16
295 0.15
296 0.16
297 0.17
298 0.16
299 0.16
300 0.17
301 0.15
302 0.15
303 0.16
304 0.15
305 0.14
306 0.13
307 0.12
308 0.09
309 0.08
310 0.09
311 0.08
312 0.08
313 0.07
314 0.07
315 0.08
316 0.1
317 0.09
318 0.1
319 0.11
320 0.17
321 0.19
322 0.2
323 0.24
324 0.26
325 0.28
326 0.28
327 0.32
328 0.31
329 0.34
330 0.36
331 0.34
332 0.32
333 0.31
334 0.34
335 0.34
336 0.32
337 0.27
338 0.25
339 0.23
340 0.22
341 0.21
342 0.17
343 0.1
344 0.08
345 0.07
346 0.07
347 0.07
348 0.06
349 0.06
350 0.06
351 0.06
352 0.06
353 0.07
354 0.06
355 0.07
356 0.06
357 0.06
358 0.05
359 0.08
360 0.11
361 0.12
362 0.13
363 0.14
364 0.21
365 0.22
366 0.25
367 0.25
368 0.31
369 0.38
370 0.46
371 0.48
372 0.42
373 0.42
374 0.38
375 0.36
376 0.31
377 0.34
378 0.27
379 0.27
380 0.3
381 0.3
382 0.3
383 0.34
384 0.31
385 0.24
386 0.25
387 0.25
388 0.22
389 0.23
390 0.23
391 0.19
392 0.19
393 0.17
394 0.16
395 0.12
396 0.11
397 0.14
398 0.15
399 0.16
400 0.15
401 0.16
402 0.14
403 0.18
404 0.19
405 0.2
406 0.21
407 0.27
408 0.26
409 0.27
410 0.28
411 0.29
412 0.31
413 0.36
414 0.38
415 0.34
416 0.34
417 0.33
418 0.34
419 0.37
420 0.43
421 0.43
422 0.43
423 0.48
424 0.54
425 0.63
426 0.6
427 0.53
428 0.46
429 0.44
430 0.43
431 0.39
432 0.35
433 0.28
434 0.3
435 0.3
436 0.27
437 0.22
438 0.26
439 0.24
440 0.23
441 0.21
442 0.2
443 0.22
444 0.21
445 0.2
446 0.13
447 0.12
448 0.1
449 0.11
450 0.09
451 0.07
452 0.06
453 0.05
454 0.05
455 0.05
456 0.05
457 0.05
458 0.05
459 0.06
460 0.07
461 0.09
462 0.08
463 0.08
464 0.09
465 0.11
466 0.15
467 0.22
468 0.27
469 0.31
470 0.32
471 0.33
472 0.34
473 0.36
474 0.37
475 0.32
476 0.29
477 0.25
478 0.25
479 0.25
480 0.25
481 0.22
482 0.21
483 0.24
484 0.22
485 0.23
486 0.23
487 0.22
488 0.24
489 0.26
490 0.23
491 0.19
492 0.2
493 0.18
494 0.22
495 0.26
496 0.3
497 0.32
498 0.33
499 0.34
500 0.35
501 0.38
502 0.35
503 0.36
504 0.28
505 0.28
506 0.27
507 0.25
508 0.22
509 0.18
510 0.18
511 0.13
512 0.13
513 0.1
514 0.1
515 0.1
516 0.11
517 0.11
518 0.15
519 0.2
520 0.28
521 0.35
522 0.41
523 0.44
524 0.46
525 0.53
526 0.57
527 0.63
528 0.63
529 0.65
530 0.68