Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Y858

Protein Details
Accession A0A4Y9Y858   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-66ASRLCRATRPTGRPRRRSRDNRQATGHHydrophilic
NLS Segment(s)
PositionSequence
52-57RPRRRS
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLAPAEPTLTTACFSHVPHPRLSALSSACTFRDYHQRASASRLCRATRPTGRPRRRSRDNRQATGHGPPPEPSVNATPQPQLVPPDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.24
3 0.31
4 0.33
5 0.33
6 0.36
7 0.35
8 0.33
9 0.33
10 0.29
11 0.21
12 0.22
13 0.21
14 0.2
15 0.19
16 0.18
17 0.18
18 0.15
19 0.25
20 0.25
21 0.28
22 0.32
23 0.34
24 0.33
25 0.39
26 0.43
27 0.35
28 0.36
29 0.36
30 0.31
31 0.32
32 0.34
33 0.36
34 0.39
35 0.44
36 0.5
37 0.57
38 0.66
39 0.73
40 0.8
41 0.82
42 0.85
43 0.87
44 0.87
45 0.88
46 0.88
47 0.85
48 0.8
49 0.75
50 0.66
51 0.62
52 0.58
53 0.51
54 0.43
55 0.37
56 0.36
57 0.34
58 0.32
59 0.29
60 0.27
61 0.27
62 0.3
63 0.31
64 0.28
65 0.28
66 0.29
67 0.28