Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Y7D9

Protein Details
Accession A0A4Y9Y7D9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-79PSSAHPPCPRRRSRIPHRRRSWIRRGDTIBasic
NLS Segment(s)
PositionSequence
60-75RRRSRIPHRRRSWIRR
Subcellular Location(s) cyto 13.5, cyto_nucl 9.5, mito 5, nucl 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MVTAVHRFAATVNVLTPGDPGDSDLSAQAAVWPHGDTAFCATGPNVDVCSPSSAHPPCPRRRSRIPHRRRSWIRRGDTIVHGLGAGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.11
5 0.1
6 0.09
7 0.1
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.07
17 0.07
18 0.08
19 0.08
20 0.07
21 0.08
22 0.08
23 0.07
24 0.09
25 0.09
26 0.08
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.07
33 0.06
34 0.07
35 0.08
36 0.09
37 0.09
38 0.1
39 0.17
40 0.17
41 0.23
42 0.3
43 0.37
44 0.45
45 0.54
46 0.6
47 0.61
48 0.7
49 0.75
50 0.78
51 0.82
52 0.83
53 0.85
54 0.86
55 0.89
56 0.9
57 0.89
58 0.89
59 0.87
60 0.83
61 0.79
62 0.77
63 0.72
64 0.65
65 0.6
66 0.5
67 0.4
68 0.34