Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YTM8

Protein Details
Accession A0A4Y9YTM8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
30-61STQGPPTPCRRARPAARRPRGSHRPVQRTSPRHydrophilic
578-610RRCRLAFLKRARRTRRAPARRRHHGRRARSMGLBasic
NLS Segment(s)
PositionSequence
40-54RARPAARRPRGSHRP
587-607KRARRTRRAPARRRHHGRRAR
Subcellular Location(s) mito 17, cyto 5, plas 2, extr 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR031656  DAO_C  
IPR038299  DAO_C_sf  
IPR006076  FAD-dep_OxRdtase  
IPR036188  FAD/NAD-bd_sf  
IPR000447  G3P_DH_FAD-dep  
Gene Ontology GO:0009331  C:glycerol-3-phosphate dehydrogenase complex  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0052591  F:sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity  
GO:0006072  P:glycerol-3-phosphate metabolic process  
Pfam View protein in Pfam  
PF01266  DAO  
PF16901  DAO_C  
PROSITE View protein in PROSITE  
PS00977  FAD_G3PDH_1  
PS00978  FAD_G3PDH_2  
Amino Acid Sequences MLRKRLLSRRALAYASAGTVAAAGAGTGTSTQGPPTPCRRARPAARRPRGSHRPVQRTSPRCVRRGAGNGNGEEEFDLLVVGGGATGAGVAVDAASRGLKVALVERDDFSAGTSSKSTKLVHGGVRYLQKAVMELDYEQYKLVKEALHERKIFLQTAPYLSHMLPIMLPIYKYWQVPYYWVGCKMYDVLAGKENMESSYLMSKGKALETFPMLKSEGLVGALVYYDGQHNDARMNIALIMTAVKHGATVANKVEVTGLQKDSNGKLQGARVKDNLTGEEWNVRAKVAFLPLVVPFILANAAEHKKGIINATGPFSDTLLTLDNASHIPIVQASSGVHITLPGYYSPRTMGLLDPSTSDGRVIFFLPWEGNTIAGTTDTPSEVEREPKAQEEEIRWILEEVRRYLSPDIKVRRGDVLSAWSGLRPLVRNPAASSTEGLVRNHMIHVSDSGLLTIAGGKWTTYRAMAQETVDEAVRAFGLQDRVKSGCVTEXVRLVGSDAWSRNMFIGLIQRYGLDTDVAKHLSDNYGDRAWTVLSLAQPTGESWPLHGVRLAHQYPFIEAEVRYAVRHEYALTAADVIARRCRLAFLKRARRTRRAPARRRHHGRRARSMGLAPDVVASHVRAARGSPLLEQLTARLGLGAMGWGLPGAQSQGTRHAARRAQFEPGEVDELRGAFAKLARKELAEDGSGREEERLERAHIREIVLALPGYEAVRPKDFEYVLEETGLAKQKDVDFDEFVEICAELKDVALAPITRNLSKSLRMAIPVEKSGGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.25
4 0.18
5 0.13
6 0.11
7 0.1
8 0.07
9 0.05
10 0.04
11 0.03
12 0.03
13 0.04
14 0.04
15 0.05
16 0.06
17 0.07
18 0.09
19 0.13
20 0.17
21 0.24
22 0.32
23 0.42
24 0.46
25 0.53
26 0.6
27 0.66
28 0.74
29 0.78
30 0.81
31 0.82
32 0.86
33 0.88
34 0.87
35 0.87
36 0.87
37 0.84
38 0.82
39 0.82
40 0.82
41 0.76
42 0.8
43 0.8
44 0.75
45 0.76
46 0.77
47 0.74
48 0.67
49 0.68
50 0.61
51 0.6
52 0.64
53 0.62
54 0.6
55 0.58
56 0.55
57 0.54
58 0.5
59 0.41
60 0.32
61 0.25
62 0.16
63 0.1
64 0.09
65 0.05
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.03
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.07
88 0.13
89 0.16
90 0.19
91 0.21
92 0.22
93 0.23
94 0.23
95 0.22
96 0.18
97 0.18
98 0.15
99 0.15
100 0.16
101 0.17
102 0.19
103 0.23
104 0.23
105 0.21
106 0.27
107 0.31
108 0.34
109 0.35
110 0.35
111 0.37
112 0.42
113 0.4
114 0.35
115 0.3
116 0.25
117 0.23
118 0.22
119 0.18
120 0.13
121 0.13
122 0.16
123 0.16
124 0.16
125 0.15
126 0.14
127 0.13
128 0.13
129 0.14
130 0.12
131 0.13
132 0.24
133 0.33
134 0.4
135 0.4
136 0.41
137 0.45
138 0.47
139 0.46
140 0.36
141 0.32
142 0.27
143 0.29
144 0.29
145 0.24
146 0.23
147 0.22
148 0.23
149 0.18
150 0.16
151 0.12
152 0.12
153 0.11
154 0.1
155 0.1
156 0.09
157 0.14
158 0.17
159 0.17
160 0.18
161 0.2
162 0.2
163 0.22
164 0.26
165 0.26
166 0.26
167 0.29
168 0.28
169 0.25
170 0.26
171 0.24
172 0.21
173 0.2
174 0.18
175 0.17
176 0.19
177 0.19
178 0.19
179 0.18
180 0.18
181 0.14
182 0.13
183 0.12
184 0.1
185 0.12
186 0.13
187 0.13
188 0.13
189 0.14
190 0.14
191 0.16
192 0.16
193 0.14
194 0.15
195 0.19
196 0.23
197 0.22
198 0.23
199 0.21
200 0.19
201 0.19
202 0.17
203 0.13
204 0.1
205 0.09
206 0.06
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.05
213 0.05
214 0.07
215 0.08
216 0.09
217 0.09
218 0.1
219 0.11
220 0.1
221 0.1
222 0.09
223 0.08
224 0.07
225 0.07
226 0.06
227 0.05
228 0.05
229 0.05
230 0.04
231 0.04
232 0.05
233 0.07
234 0.08
235 0.11
236 0.12
237 0.14
238 0.14
239 0.14
240 0.15
241 0.13
242 0.15
243 0.16
244 0.17
245 0.15
246 0.16
247 0.19
248 0.2
249 0.24
250 0.23
251 0.2
252 0.2
253 0.23
254 0.27
255 0.28
256 0.29
257 0.25
258 0.26
259 0.27
260 0.27
261 0.24
262 0.21
263 0.19
264 0.16
265 0.18
266 0.16
267 0.15
268 0.14
269 0.13
270 0.11
271 0.11
272 0.12
273 0.11
274 0.11
275 0.1
276 0.11
277 0.11
278 0.12
279 0.11
280 0.09
281 0.07
282 0.06
283 0.06
284 0.05
285 0.05
286 0.09
287 0.1
288 0.1
289 0.11
290 0.11
291 0.11
292 0.13
293 0.14
294 0.11
295 0.11
296 0.13
297 0.15
298 0.15
299 0.14
300 0.13
301 0.12
302 0.11
303 0.09
304 0.08
305 0.07
306 0.08
307 0.07
308 0.07
309 0.08
310 0.07
311 0.08
312 0.07
313 0.05
314 0.05
315 0.05
316 0.06
317 0.05
318 0.05
319 0.05
320 0.06
321 0.07
322 0.06
323 0.06
324 0.05
325 0.06
326 0.05
327 0.06
328 0.05
329 0.07
330 0.08
331 0.08
332 0.09
333 0.09
334 0.1
335 0.1
336 0.1
337 0.12
338 0.13
339 0.13
340 0.13
341 0.14
342 0.13
343 0.13
344 0.12
345 0.09
346 0.08
347 0.08
348 0.09
349 0.06
350 0.06
351 0.07
352 0.07
353 0.07
354 0.09
355 0.08
356 0.08
357 0.07
358 0.08
359 0.07
360 0.07
361 0.07
362 0.05
363 0.05
364 0.05
365 0.05
366 0.06
367 0.08
368 0.08
369 0.11
370 0.11
371 0.13
372 0.14
373 0.15
374 0.17
375 0.15
376 0.17
377 0.16
378 0.2
379 0.19
380 0.19
381 0.17
382 0.15
383 0.16
384 0.16
385 0.16
386 0.13
387 0.14
388 0.14
389 0.16
390 0.18
391 0.2
392 0.22
393 0.27
394 0.3
395 0.33
396 0.34
397 0.33
398 0.34
399 0.3
400 0.27
401 0.21
402 0.19
403 0.15
404 0.15
405 0.14
406 0.1
407 0.1
408 0.1
409 0.11
410 0.09
411 0.09
412 0.16
413 0.17
414 0.18
415 0.18
416 0.22
417 0.22
418 0.22
419 0.21
420 0.15
421 0.19
422 0.2
423 0.19
424 0.16
425 0.15
426 0.15
427 0.15
428 0.14
429 0.1
430 0.08
431 0.09
432 0.09
433 0.09
434 0.08
435 0.08
436 0.07
437 0.06
438 0.06
439 0.06
440 0.05
441 0.04
442 0.04
443 0.04
444 0.05
445 0.06
446 0.07
447 0.07
448 0.08
449 0.09
450 0.12
451 0.13
452 0.13
453 0.13
454 0.13
455 0.13
456 0.12
457 0.1
458 0.07
459 0.06
460 0.06
461 0.05
462 0.04
463 0.06
464 0.11
465 0.12
466 0.13
467 0.15
468 0.17
469 0.17
470 0.17
471 0.15
472 0.15
473 0.16
474 0.18
475 0.17
476 0.18
477 0.18
478 0.18
479 0.18
480 0.13
481 0.14
482 0.15
483 0.13
484 0.14
485 0.14
486 0.14
487 0.14
488 0.14
489 0.12
490 0.09
491 0.15
492 0.14
493 0.14
494 0.14
495 0.14
496 0.14
497 0.14
498 0.13
499 0.08
500 0.07
501 0.08
502 0.11
503 0.12
504 0.11
505 0.11
506 0.12
507 0.12
508 0.14
509 0.14
510 0.14
511 0.14
512 0.14
513 0.14
514 0.14
515 0.12
516 0.11
517 0.1
518 0.08
519 0.08
520 0.1
521 0.1
522 0.09
523 0.09
524 0.1
525 0.11
526 0.12
527 0.11
528 0.11
529 0.17
530 0.18
531 0.18
532 0.19
533 0.18
534 0.19
535 0.27
536 0.28
537 0.22
538 0.23
539 0.23
540 0.22
541 0.23
542 0.2
543 0.13
544 0.12
545 0.13
546 0.15
547 0.15
548 0.14
549 0.13
550 0.13
551 0.12
552 0.13
553 0.11
554 0.09
555 0.1
556 0.11
557 0.1
558 0.09
559 0.08
560 0.11
561 0.12
562 0.12
563 0.16
564 0.15
565 0.15
566 0.15
567 0.18
568 0.22
569 0.27
570 0.35
571 0.42
572 0.52
573 0.6
574 0.71
575 0.76
576 0.79
577 0.8
578 0.82
579 0.82
580 0.82
581 0.84
582 0.84
583 0.87
584 0.89
585 0.92
586 0.91
587 0.91
588 0.89
589 0.89
590 0.89
591 0.86
592 0.79
593 0.72
594 0.64
595 0.57
596 0.5
597 0.41
598 0.3
599 0.23
600 0.19
601 0.16
602 0.14
603 0.11
604 0.11
605 0.13
606 0.13
607 0.12
608 0.13
609 0.16
610 0.18
611 0.18
612 0.16
613 0.2
614 0.2
615 0.21
616 0.2
617 0.17
618 0.17
619 0.16
620 0.15
621 0.1
622 0.08
623 0.08
624 0.08
625 0.07
626 0.04
627 0.04
628 0.04
629 0.04
630 0.04
631 0.03
632 0.04
633 0.05
634 0.06
635 0.08
636 0.09
637 0.17
638 0.23
639 0.25
640 0.29
641 0.35
642 0.39
643 0.42
644 0.47
645 0.42
646 0.44
647 0.42
648 0.41
649 0.36
650 0.34
651 0.34
652 0.28
653 0.27
654 0.2
655 0.2
656 0.19
657 0.16
658 0.14
659 0.1
660 0.14
661 0.2
662 0.21
663 0.26
664 0.27
665 0.26
666 0.29
667 0.32
668 0.31
669 0.26
670 0.25
671 0.23
672 0.26
673 0.25
674 0.23
675 0.2
676 0.18
677 0.18
678 0.21
679 0.21
680 0.21
681 0.26
682 0.28
683 0.34
684 0.35
685 0.35
686 0.33
687 0.31
688 0.27
689 0.24
690 0.21
691 0.15
692 0.12
693 0.12
694 0.1
695 0.11
696 0.14
697 0.15
698 0.19
699 0.21
700 0.22
701 0.28
702 0.28
703 0.27
704 0.3
705 0.3
706 0.27
707 0.26
708 0.25
709 0.19
710 0.24
711 0.3
712 0.24
713 0.2
714 0.23
715 0.25
716 0.31
717 0.34
718 0.33
719 0.28
720 0.3
721 0.34
722 0.3
723 0.28
724 0.23
725 0.19
726 0.15
727 0.14
728 0.12
729 0.07
730 0.07
731 0.08
732 0.08
733 0.08
734 0.11
735 0.12
736 0.13
737 0.2
738 0.24
739 0.24
740 0.25
741 0.29
742 0.3
743 0.34
744 0.36
745 0.36
746 0.35
747 0.37
748 0.39
749 0.4
750 0.41
751 0.39
752 0.37