Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YM97

Protein Details
Accession A0A4Y9YM97    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-123LLLLRAPRRARRRAPQRDGGRRPRGLRBasic
350-369SVPGPAPRARRRGRRLVSSGHydrophilic
NLS Segment(s)
PositionSequence
101-125RAPRRARRRAPQRDGGRRPRGLRXR
357-365PRARRRGRR
Subcellular Location(s) mito 10, cyto 4, plas 4, extr 4, E.R. 2, nucl 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MSPFHLHCTCLLTFYRDAGLIQTKRIAIETTAKAKTKTPAPPLVVHNPRPLAPHTLRLLRRLPHARCISLRSPQPRQVPVFYSSWSAPFPGRRAGFLLLLRAPRRARRRAPQRDGGRRPRGLRXRGTTCCRPTACRGASPLMRIAAASTAGGVRRMLLRDGLVTEEMLALGGAYRESFRSCGRPVGGFGRPFPVDFEKGSWYVRVVVGAETKRMQFWNTLTSPEMAPYFKVRAFGVLCMHVLNLNVNAHVRCCIAGKAICCFERSTLPQHTGLRVVVIRVLKIVSPLVQLLPLPPKRAMDTPRAGALLTRRGRPCPTNVEKHAGSARRQALRLLFKSEQQEEAAMEVQLGSVPGPAPRARRRGRRLVSSGGRVELLPWLGRTGRYSLQTRGFVLIMPHSDGARLQGLGVLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.22
4 0.22
5 0.22
6 0.3
7 0.26
8 0.27
9 0.3
10 0.29
11 0.29
12 0.3
13 0.26
14 0.2
15 0.27
16 0.31
17 0.35
18 0.4
19 0.42
20 0.42
21 0.45
22 0.48
23 0.47
24 0.5
25 0.5
26 0.52
27 0.54
28 0.59
29 0.61
30 0.66
31 0.66
32 0.62
33 0.61
34 0.55
35 0.52
36 0.5
37 0.46
38 0.44
39 0.38
40 0.41
41 0.4
42 0.46
43 0.47
44 0.49
45 0.53
46 0.47
47 0.54
48 0.57
49 0.55
50 0.56
51 0.59
52 0.57
53 0.54
54 0.58
55 0.53
56 0.51
57 0.56
58 0.54
59 0.57
60 0.6
61 0.64
62 0.63
63 0.63
64 0.6
65 0.56
66 0.51
67 0.45
68 0.39
69 0.35
70 0.29
71 0.26
72 0.22
73 0.2
74 0.19
75 0.22
76 0.23
77 0.27
78 0.27
79 0.27
80 0.29
81 0.3
82 0.31
83 0.27
84 0.29
85 0.24
86 0.29
87 0.29
88 0.32
89 0.33
90 0.37
91 0.45
92 0.5
93 0.56
94 0.61
95 0.71
96 0.77
97 0.82
98 0.83
99 0.85
100 0.87
101 0.88
102 0.88
103 0.86
104 0.81
105 0.78
106 0.78
107 0.76
108 0.71
109 0.68
110 0.66
111 0.66
112 0.66
113 0.7
114 0.63
115 0.59
116 0.56
117 0.52
118 0.5
119 0.5
120 0.47
121 0.4
122 0.41
123 0.42
124 0.4
125 0.38
126 0.35
127 0.25
128 0.23
129 0.2
130 0.17
131 0.12
132 0.1
133 0.08
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.09
141 0.1
142 0.1
143 0.1
144 0.1
145 0.1
146 0.11
147 0.11
148 0.09
149 0.08
150 0.08
151 0.07
152 0.06
153 0.05
154 0.05
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.05
163 0.07
164 0.09
165 0.13
166 0.14
167 0.17
168 0.18
169 0.18
170 0.2
171 0.23
172 0.26
173 0.23
174 0.22
175 0.23
176 0.21
177 0.21
178 0.21
179 0.19
180 0.17
181 0.16
182 0.17
183 0.16
184 0.17
185 0.17
186 0.15
187 0.12
188 0.12
189 0.12
190 0.11
191 0.09
192 0.08
193 0.12
194 0.12
195 0.13
196 0.13
197 0.13
198 0.13
199 0.13
200 0.13
201 0.11
202 0.12
203 0.18
204 0.17
205 0.18
206 0.18
207 0.19
208 0.18
209 0.17
210 0.17
211 0.1
212 0.1
213 0.11
214 0.13
215 0.12
216 0.14
217 0.13
218 0.15
219 0.15
220 0.16
221 0.16
222 0.15
223 0.14
224 0.13
225 0.13
226 0.1
227 0.09
228 0.08
229 0.09
230 0.08
231 0.08
232 0.1
233 0.1
234 0.09
235 0.1
236 0.1
237 0.08
238 0.09
239 0.09
240 0.11
241 0.14
242 0.14
243 0.16
244 0.2
245 0.2
246 0.2
247 0.2
248 0.18
249 0.21
250 0.22
251 0.25
252 0.26
253 0.28
254 0.31
255 0.32
256 0.32
257 0.29
258 0.26
259 0.23
260 0.19
261 0.17
262 0.16
263 0.14
264 0.13
265 0.12
266 0.12
267 0.1
268 0.11
269 0.11
270 0.09
271 0.09
272 0.1
273 0.09
274 0.09
275 0.09
276 0.11
277 0.19
278 0.2
279 0.22
280 0.23
281 0.24
282 0.26
283 0.32
284 0.34
285 0.33
286 0.36
287 0.35
288 0.36
289 0.35
290 0.32
291 0.28
292 0.28
293 0.29
294 0.28
295 0.32
296 0.33
297 0.36
298 0.41
299 0.42
300 0.44
301 0.45
302 0.49
303 0.52
304 0.54
305 0.57
306 0.53
307 0.54
308 0.55
309 0.49
310 0.44
311 0.43
312 0.46
313 0.44
314 0.45
315 0.44
316 0.44
317 0.49
318 0.48
319 0.47
320 0.42
321 0.41
322 0.47
323 0.46
324 0.41
325 0.33
326 0.31
327 0.24
328 0.24
329 0.21
330 0.14
331 0.12
332 0.1
333 0.09
334 0.08
335 0.07
336 0.05
337 0.05
338 0.06
339 0.07
340 0.11
341 0.14
342 0.22
343 0.3
344 0.41
345 0.49
346 0.59
347 0.67
348 0.74
349 0.79
350 0.81
351 0.79
352 0.79
353 0.77
354 0.74
355 0.68
356 0.59
357 0.51
358 0.41
359 0.36
360 0.29
361 0.24
362 0.18
363 0.15
364 0.17
365 0.17
366 0.19
367 0.21
368 0.22
369 0.25
370 0.3
371 0.34
372 0.38
373 0.44
374 0.45
375 0.45
376 0.43
377 0.38
378 0.33
379 0.31
380 0.29
381 0.24
382 0.24
383 0.23
384 0.2
385 0.21
386 0.2
387 0.21
388 0.19
389 0.16
390 0.13