Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XVL8

Protein Details
Accession A0A4Y9XVL8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-109LKTDTKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.5, pero 2, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MTRPLQRPCEQFWSRAPRLLGLCRAFALCHQLYRVATGDNLIFHTDANVPHDAARSSEMPSQKTFRTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.49
4 0.44
5 0.46
6 0.46
7 0.45
8 0.37
9 0.35
10 0.31
11 0.3
12 0.26
13 0.22
14 0.24
15 0.18
16 0.17
17 0.17
18 0.19
19 0.19
20 0.2
21 0.2
22 0.14
23 0.13
24 0.13
25 0.13
26 0.1
27 0.11
28 0.09
29 0.08
30 0.07
31 0.09
32 0.09
33 0.09
34 0.11
35 0.11
36 0.11
37 0.11
38 0.12
39 0.11
40 0.1
41 0.11
42 0.1
43 0.11
44 0.14
45 0.16
46 0.17
47 0.19
48 0.21
49 0.22
50 0.3
51 0.31
52 0.34
53 0.39
54 0.42
55 0.48
56 0.55
57 0.6
58 0.55
59 0.62
60 0.66
61 0.67
62 0.7
63 0.65
64 0.62
65 0.61
66 0.64
67 0.65
68 0.61
69 0.59
70 0.62
71 0.6
72 0.6
73 0.6
74 0.57
75 0.51
76 0.55
77 0.58
78 0.52
79 0.57
80 0.6
81 0.63
82 0.69
83 0.74
84 0.75
85 0.77
86 0.79
87 0.83
88 0.85
89 0.86