FuNGI

A0A4Y9ZA61

Protein Details

Accession

A0A4Y9ZA61

Localization Confidence

High

Confidence Score

18.2

NoLS Segment(s)

Position	Sequence	Protein Nature
267-287	EEPPARQSQRRKRGKYADGRT	Basic
396-432	DKSPYSQSKAERRTEKNRRRRERRKFFIFNGRRKNTP	Basic
445-469	MAAPCTNTRRCRERQEKAPGVKFSG	Hydrophilic

NLS Segment(s)

Position	Sequence
405-422	AERRTEKNRRRRERRKFF

Subcellular Location(s)

nucl 20.5, cyto_nucl 13.5, cyto 5.5

Family & Domain DBs

Amino Acid Sequences

MSSIPENPSLDALLEGMNTLKGCWPVGPVESPSPEEYSLGDVGRRDSVVTIEELTEVEDPLKINWWDWIHGRGEPSEEIRRVLFVSNADFSERSVDDPKALRIWGYIHDNVPGSQPTTALKVRSTRRSTKNGTNPHRPQHGDSNEGGEEPPAPSNEVSAAPSQREGQSDAPVQHSDTEEAPPARQRQLRQRVKFADGRTDNVPGAQPTTAFNVRPSRRSTKNGTNPHRPQQQDSNEEGEEPPAPSDTAPSQQEGQSDAPAQHSDIEEEPPARQSQRRKRGKYADGRTDDVPSKIAARWEKAKMAIHVESHHERAGKRSREEDSSSEGAAALAPPAIGREEGAQVATPEGASRDAMDPESDDEVERAEDMRHQGTSAKVRELACRILRTSKLISDPDKSPYSQSKAERRTEKNRRRRERRKFFIFNGRRKNTPYHPNLGLILEVTMAAPCTNTRRCRERQEKAPGVKFSGLPI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.09
2	0.09
3	0.08
4	0.09
5	0.09
6	0.09
7	0.12
8	0.13
9	0.14
10	0.14
11	0.16
12	0.17
13	0.2
14	0.23
15	0.24
16	0.28
17	0.3
18	0.32
19	0.32
20	0.32
21	0.29
22	0.26
23	0.23
24	0.21
25	0.21
26	0.19
27	0.18
28	0.16
29	0.18
30	0.19
31	0.19
32	0.16
33	0.14
34	0.14
35	0.14
36	0.15
37	0.14
38	0.12
39	0.12
40	0.12
41	0.13
42	0.12
43	0.11
44	0.1
45	0.1
46	0.1
47	0.1
48	0.16
49	0.15
50	0.14
51	0.2
52	0.22
53	0.23
54	0.25
55	0.29
56	0.25
57	0.27
58	0.29
59	0.24
60	0.25
61	0.24
62	0.28
63	0.3
64	0.29
65	0.29
66	0.27
67	0.27
68	0.25
69	0.24
70	0.21
71	0.15
72	0.18
73	0.18
74	0.18
75	0.19
76	0.18
77	0.17
78	0.2
79	0.18
80	0.18
81	0.19
82	0.19
83	0.21
84	0.23
85	0.25
86	0.23
87	0.23
88	0.2
89	0.17
90	0.19
91	0.19
92	0.23
93	0.24
94	0.22
95	0.24
96	0.25
97	0.24
98	0.25
99	0.21
100	0.16
101	0.14
102	0.14
103	0.13
104	0.17
105	0.19
106	0.18
107	0.2
108	0.26
109	0.33
110	0.42
111	0.48
112	0.53
113	0.58
114	0.66
115	0.69
116	0.72
117	0.74
118	0.75
119	0.76
120	0.77
121	0.77
122	0.75
123	0.76
124	0.69
125	0.63
126	0.63
127	0.58
128	0.51
129	0.45
130	0.42
131	0.34
132	0.32
133	0.28
134	0.18
135	0.15
136	0.12
137	0.13
138	0.09
139	0.1
140	0.09
141	0.1
142	0.11
143	0.11
144	0.12
145	0.13
146	0.14
147	0.13
148	0.15
149	0.16
150	0.16
151	0.17
152	0.18
153	0.17
154	0.2
155	0.22
156	0.22
157	0.23
158	0.22
159	0.21
160	0.19
161	0.19
162	0.16
163	0.14
164	0.14
165	0.15
166	0.15
167	0.15
168	0.18
169	0.2
170	0.24
171	0.27
172	0.3
173	0.37
174	0.48
175	0.57
176	0.57
177	0.63
178	0.61
179	0.63
180	0.64
181	0.54
182	0.53
183	0.44
184	0.43
185	0.36
186	0.34
187	0.29
188	0.24
189	0.24
190	0.14
191	0.14
192	0.11
193	0.09
194	0.08
195	0.13
196	0.14
197	0.13
198	0.16
199	0.24
200	0.26
201	0.29
202	0.34
203	0.37
204	0.41
205	0.45
206	0.49
207	0.5
208	0.59
209	0.65
210	0.67
211	0.71
212	0.71
213	0.75
214	0.75
215	0.66
216	0.6
217	0.58
218	0.57
219	0.51
220	0.48
221	0.43
222	0.36
223	0.35
224	0.31
225	0.23
226	0.17
227	0.12
228	0.1
229	0.07
230	0.07
231	0.06
232	0.08
233	0.08
234	0.11
235	0.12
236	0.13
237	0.14
238	0.15
239	0.15
240	0.17
241	0.16
242	0.13
243	0.13
244	0.13
245	0.13
246	0.12
247	0.12
248	0.1
249	0.09
250	0.1
251	0.1
252	0.11
253	0.11
254	0.11
255	0.11
256	0.11
257	0.12
258	0.13
259	0.16
260	0.25
261	0.35
262	0.45
263	0.55
264	0.6
265	0.68
266	0.76
267	0.8
268	0.81
269	0.79
270	0.78
271	0.72
272	0.69
273	0.6
274	0.54
275	0.46
276	0.36
277	0.28
278	0.19
279	0.17
280	0.15
281	0.19
282	0.18
283	0.2
284	0.25
285	0.27
286	0.29
287	0.3
288	0.32
289	0.29
290	0.31
291	0.3
292	0.26
293	0.25
294	0.29
295	0.28
296	0.27
297	0.27
298	0.25
299	0.23
300	0.29
301	0.37
302	0.38
303	0.38
304	0.41
305	0.42
306	0.44
307	0.48
308	0.43
309	0.4
310	0.35
311	0.32
312	0.27
313	0.24
314	0.19
315	0.15
316	0.12
317	0.06
318	0.04
319	0.04
320	0.04
321	0.04
322	0.05
323	0.05
324	0.05
325	0.07
326	0.08
327	0.08
328	0.09
329	0.09
330	0.08
331	0.09
332	0.08
333	0.07
334	0.06
335	0.06
336	0.07
337	0.07
338	0.08
339	0.09
340	0.1
341	0.11
342	0.11
343	0.11
344	0.13
345	0.15
346	0.13
347	0.12
348	0.11
349	0.11
350	0.11
351	0.1
352	0.09
353	0.07
354	0.1
355	0.13
356	0.15
357	0.14
358	0.15
359	0.17
360	0.21
361	0.29
362	0.29
363	0.28
364	0.31
365	0.32
366	0.37
367	0.38
368	0.41
369	0.37
370	0.38
371	0.38
372	0.39
373	0.4
374	0.39
375	0.39
376	0.36
377	0.37
378	0.39
379	0.4
380	0.39
381	0.39
382	0.4
383	0.4
384	0.37
385	0.37
386	0.39
387	0.41
388	0.44
389	0.49
390	0.54
391	0.59
392	0.67
393	0.71
394	0.72
395	0.78
396	0.82
397	0.84
398	0.85
399	0.88
400	0.9
401	0.92
402	0.95
403	0.95
404	0.95
405	0.95
406	0.95
407	0.93
408	0.89
409	0.89
410	0.88
411	0.87
412	0.87
413	0.81
414	0.75
415	0.71
416	0.71
417	0.68
418	0.69
419	0.66
420	0.62
421	0.6
422	0.58
423	0.56
424	0.48
425	0.39
426	0.29
427	0.22
428	0.14
429	0.11
430	0.09
431	0.07
432	0.07
433	0.06
434	0.06
435	0.08
436	0.16
437	0.24
438	0.32
439	0.4
440	0.48
441	0.56
442	0.67
443	0.75
444	0.78
445	0.8
446	0.84
447	0.86
448	0.87
449	0.88
450	0.8
451	0.75
452	0.68

A0A4Y9ZA61

3D AlphaFold-predicted Structure Viewer