Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XN57

Protein Details
Accession A0A4Y9XN57   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-92LIWYLVPRCRRSRSRRSPRPARTHydrophilic
NLS Segment(s)
PositionSequence
80-91RSRSRRSPRPAR
Subcellular Location(s) extr 16, plas 8, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008972  Cupredoxin  
Amino Acid Sequences MRFSTVLAAALPIAAVSAANFQVQVGANGGLAYDPPVVNASVGDTISFVFMAKNHVSPPHLIWEHGQSDLIWYLVPRCRRSRSRRSPRPART
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.05
5 0.06
6 0.06
7 0.07
8 0.06
9 0.09
10 0.09
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.06
18 0.05
19 0.06
20 0.06
21 0.05
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.08
39 0.09
40 0.1
41 0.1
42 0.12
43 0.13
44 0.14
45 0.16
46 0.2
47 0.19
48 0.19
49 0.2
50 0.23
51 0.24
52 0.23
53 0.22
54 0.13
55 0.15
56 0.15
57 0.13
58 0.09
59 0.08
60 0.12
61 0.16
62 0.23
63 0.26
64 0.33
65 0.42
66 0.52
67 0.62
68 0.69
69 0.75
70 0.81
71 0.86
72 0.9