Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZGE4

Protein Details
Accession A0A4Y9ZGE4    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-58QRKYAVCRYVNRRRRGHRKDMRYAYSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, nucl 3, mito 3, cyto 3, cyto_nucl 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MLNLGPNLPGTTPDSTAPGPQASSIMPWRLEVQRKYAVCRYVNRRRRGHRKDMRYAYSVPAENRDAPSVKDTPKKSLLGSARIVLPLTFIVIEQKERYFELASGYSRALESPRPGCTIFNLDFWAVMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.22
5 0.19
6 0.17
7 0.15
8 0.16
9 0.12
10 0.15
11 0.17
12 0.18
13 0.17
14 0.17
15 0.21
16 0.26
17 0.33
18 0.32
19 0.34
20 0.39
21 0.39
22 0.44
23 0.45
24 0.45
25 0.41
26 0.48
27 0.51
28 0.55
29 0.62
30 0.66
31 0.7
32 0.74
33 0.81
34 0.82
35 0.84
36 0.82
37 0.82
38 0.84
39 0.83
40 0.77
41 0.69
42 0.61
43 0.53
44 0.47
45 0.4
46 0.3
47 0.25
48 0.23
49 0.2
50 0.2
51 0.19
52 0.16
53 0.14
54 0.17
55 0.17
56 0.19
57 0.25
58 0.25
59 0.29
60 0.33
61 0.33
62 0.3
63 0.34
64 0.34
65 0.32
66 0.32
67 0.28
68 0.25
69 0.24
70 0.24
71 0.16
72 0.13
73 0.09
74 0.08
75 0.06
76 0.05
77 0.08
78 0.09
79 0.11
80 0.12
81 0.13
82 0.14
83 0.15
84 0.17
85 0.15
86 0.15
87 0.17
88 0.18
89 0.19
90 0.19
91 0.19
92 0.17
93 0.16
94 0.17
95 0.15
96 0.15
97 0.2
98 0.22
99 0.25
100 0.27
101 0.28
102 0.28
103 0.3
104 0.33
105 0.29
106 0.28
107 0.28
108 0.24