Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Z0C5

Protein Details
Accession A0A4Y9Z0C5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-111TWYCEACLKKKNKRSARGGKRRSGGGHydrophilic
NLS Segment(s)
PositionSequence
95-117KKKNKRSARGGKRRSGGGARSGA
Subcellular Location(s) cysk 9, cyto 8, mito 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences MLEGPGMPVARSVVPPATALVGPGIXGGATTDAGEPGELDGEGDDGKRYCWCNMPSYGEMIACDMPGCEREWFHVGCLQLETPPGDTWYCEACLKKKNKRSARGGKRRSGGGARSGARAATASTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.14
6 0.13
7 0.11
8 0.09
9 0.08
10 0.07
11 0.07
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.06
31 0.05
32 0.06
33 0.09
34 0.11
35 0.11
36 0.18
37 0.19
38 0.22
39 0.25
40 0.29
41 0.27
42 0.28
43 0.27
44 0.21
45 0.19
46 0.16
47 0.13
48 0.08
49 0.07
50 0.05
51 0.05
52 0.05
53 0.07
54 0.06
55 0.06
56 0.09
57 0.12
58 0.12
59 0.13
60 0.15
61 0.14
62 0.13
63 0.14
64 0.12
65 0.1
66 0.11
67 0.11
68 0.1
69 0.1
70 0.11
71 0.1
72 0.1
73 0.11
74 0.12
75 0.13
76 0.14
77 0.16
78 0.2
79 0.29
80 0.38
81 0.46
82 0.53
83 0.62
84 0.69
85 0.76
86 0.82
87 0.85
88 0.87
89 0.89
90 0.89
91 0.86
92 0.81
93 0.75
94 0.7
95 0.65
96 0.57
97 0.53
98 0.52
99 0.46
100 0.44
101 0.41
102 0.35
103 0.29
104 0.26
105 0.2