Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9YT45

Protein Details
Accession A0A4Y9YT45    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
170-191GVYRNALPKKPRDRNRPGVCGIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDADEETIHKEFSPPENKVSFAEQRPASLTPPRFSGDVDATLAQVSREDGRRMGVARCRRRVPRAILLVRTAERVRDVPGVVCATPAEPPPTVDDRVDRISAALGVFLLGHICGPRIRHIWSALHPRGGLVRDGVRAHDDEPVHALLPVHAGAGCTVQRRGRHAVLLLTGVYRNALPKKPRDRNRPGVCGIRRRCAGLFRFRRPRADRDPCVGDAGGTVFPIVFPRLFALVGFAWAVRIVGFVSLACCALAAADGHAGMRPAAGARRRGGVGWVDVAAVKDGRFMLLAVGCAFVCFGLFIPYFFITSYTQAIARVQEHDVSRPSGSGSFSTSLAILXAASVLGRTLPPLIADRIGPYNTLVPAVTLAGLSCFALWLPAGSGNAHEVLAARRAGGRERDAGAAGGGVRGGVWIREWGSDRGDHAVCRAHLGRAADWSLFGGPAAGALIGLAGGSYTGVIALAGSTLLIGAVFVAWARFSVDSRPCAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.42
4 0.44
5 0.44
6 0.46
7 0.45
8 0.41
9 0.47
10 0.4
11 0.4
12 0.42
13 0.42
14 0.38
15 0.39
16 0.4
17 0.34
18 0.37
19 0.37
20 0.34
21 0.33
22 0.35
23 0.3
24 0.27
25 0.27
26 0.24
27 0.22
28 0.22
29 0.21
30 0.15
31 0.12
32 0.11
33 0.14
34 0.18
35 0.2
36 0.2
37 0.22
38 0.25
39 0.27
40 0.32
41 0.35
42 0.41
43 0.49
44 0.56
45 0.63
46 0.67
47 0.73
48 0.76
49 0.75
50 0.75
51 0.75
52 0.74
53 0.69
54 0.65
55 0.62
56 0.53
57 0.5
58 0.4
59 0.31
60 0.27
61 0.25
62 0.25
63 0.23
64 0.23
65 0.19
66 0.23
67 0.24
68 0.21
69 0.2
70 0.17
71 0.14
72 0.15
73 0.16
74 0.16
75 0.14
76 0.15
77 0.2
78 0.24
79 0.25
80 0.25
81 0.26
82 0.27
83 0.3
84 0.29
85 0.24
86 0.2
87 0.18
88 0.18
89 0.15
90 0.11
91 0.07
92 0.06
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.06
100 0.07
101 0.09
102 0.14
103 0.17
104 0.2
105 0.23
106 0.26
107 0.3
108 0.35
109 0.44
110 0.42
111 0.42
112 0.39
113 0.36
114 0.36
115 0.33
116 0.27
117 0.18
118 0.18
119 0.19
120 0.2
121 0.2
122 0.19
123 0.18
124 0.18
125 0.21
126 0.19
127 0.16
128 0.18
129 0.18
130 0.15
131 0.15
132 0.14
133 0.09
134 0.1
135 0.1
136 0.07
137 0.07
138 0.07
139 0.06
140 0.09
141 0.1
142 0.1
143 0.13
144 0.16
145 0.19
146 0.23
147 0.29
148 0.29
149 0.29
150 0.29
151 0.28
152 0.26
153 0.24
154 0.2
155 0.15
156 0.13
157 0.11
158 0.09
159 0.08
160 0.11
161 0.14
162 0.19
163 0.23
164 0.32
165 0.43
166 0.53
167 0.62
168 0.69
169 0.74
170 0.8
171 0.83
172 0.81
173 0.74
174 0.73
175 0.69
176 0.69
177 0.63
178 0.59
179 0.52
180 0.47
181 0.44
182 0.42
183 0.42
184 0.42
185 0.47
186 0.49
187 0.59
188 0.59
189 0.67
190 0.65
191 0.68
192 0.68
193 0.69
194 0.63
195 0.58
196 0.6
197 0.51
198 0.48
199 0.4
200 0.29
201 0.2
202 0.17
203 0.12
204 0.08
205 0.07
206 0.05
207 0.05
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.08
217 0.07
218 0.07
219 0.07
220 0.06
221 0.05
222 0.05
223 0.06
224 0.03
225 0.04
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.03
236 0.03
237 0.04
238 0.03
239 0.03
240 0.03
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.03
248 0.04
249 0.08
250 0.11
251 0.14
252 0.14
253 0.17
254 0.17
255 0.17
256 0.18
257 0.16
258 0.14
259 0.12
260 0.11
261 0.09
262 0.09
263 0.09
264 0.08
265 0.07
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.07
275 0.06
276 0.07
277 0.06
278 0.06
279 0.06
280 0.05
281 0.04
282 0.04
283 0.04
284 0.07
285 0.07
286 0.07
287 0.1
288 0.1
289 0.11
290 0.11
291 0.13
292 0.1
293 0.11
294 0.13
295 0.11
296 0.11
297 0.12
298 0.12
299 0.12
300 0.12
301 0.13
302 0.13
303 0.16
304 0.16
305 0.19
306 0.2
307 0.19
308 0.19
309 0.17
310 0.17
311 0.15
312 0.15
313 0.13
314 0.14
315 0.14
316 0.14
317 0.14
318 0.13
319 0.11
320 0.1
321 0.09
322 0.05
323 0.04
324 0.04
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.04
331 0.05
332 0.05
333 0.06
334 0.08
335 0.1
336 0.11
337 0.11
338 0.13
339 0.15
340 0.16
341 0.15
342 0.14
343 0.15
344 0.14
345 0.15
346 0.12
347 0.09
348 0.09
349 0.09
350 0.08
351 0.06
352 0.05
353 0.05
354 0.06
355 0.05
356 0.05
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.05
363 0.07
364 0.08
365 0.08
366 0.09
367 0.1
368 0.11
369 0.1
370 0.09
371 0.09
372 0.09
373 0.13
374 0.12
375 0.11
376 0.13
377 0.14
378 0.19
379 0.23
380 0.24
381 0.25
382 0.27
383 0.28
384 0.26
385 0.25
386 0.2
387 0.17
388 0.14
389 0.1
390 0.07
391 0.06
392 0.05
393 0.05
394 0.05
395 0.05
396 0.05
397 0.08
398 0.09
399 0.13
400 0.16
401 0.18
402 0.21
403 0.22
404 0.23
405 0.26
406 0.26
407 0.23
408 0.23
409 0.26
410 0.24
411 0.28
412 0.28
413 0.24
414 0.26
415 0.28
416 0.27
417 0.26
418 0.28
419 0.22
420 0.21
421 0.2
422 0.18
423 0.15
424 0.13
425 0.09
426 0.07
427 0.07
428 0.07
429 0.05
430 0.04
431 0.04
432 0.04
433 0.03
434 0.03
435 0.03
436 0.02
437 0.02
438 0.02
439 0.03
440 0.02
441 0.03
442 0.03
443 0.03
444 0.03
445 0.03
446 0.03
447 0.03
448 0.03
449 0.03
450 0.03
451 0.03
452 0.03
453 0.03
454 0.03
455 0.03
456 0.03
457 0.03
458 0.04
459 0.04
460 0.05
461 0.07
462 0.08
463 0.1
464 0.18
465 0.24
466 0.3