Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Z950

Protein Details
Accession A0A4Y9Z950    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
478-500HAQVCKYPEKARKRKQDLTSHDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR004589  DNA_helicase_ATP-dep_RecQ  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR032284  RecQ_Zn-bd  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0004386  F:helicase activity  
GO:0003676  F:nucleic acid binding  
GO:0006310  P:DNA recombination  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PF16124  RecQ_Zn_bind  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
CDD cd17920  DEXHc_RecQ  
Amino Acid Sequences MKHDYEVLDDTASSSSAGGWVGRKEPNATVDCHSVLTGVFGYSEYKGKQKEIFEAAVLGADVFVVAPTGMGKVPAIADDHGISIVVSPLLALMKNQVARLRQSNVQVASLSSETPPFEKEEILEDLSIGSPVNRLLYITPEKLCTSNFMKILTQLHQRGELNRLVVDEAHCISEWGHDFRAEYRQLGRFRQKFPDIPIMALTASATALVQDDIVKSLRMSSQHLFKVVHPFNRPNLYYEVRTSVRYHAWTSPDSQMEDIFNYINGLHRRRNRPSSGIIYCRTRATCDELSGYLRRRGLSSRPYHRGIKSNVLDKTLXEWEQGGNGDGGVDVVCATIAFGMGIDKSDVRYIIHFDLPKSFEGYYQETGRAGRDGSASKCVLYYSREDAIRVRKLVSLGYNRRQITAESANEPPPSQRSVDSLTTLLNFAEGVEVCRHVLVCRYFGESIDAKDSEAVKSYCNQMCDVSAPNSIDDATIKDHAQVCKYPEKARKRKQDLTSHDIIGTQMAKLQRETVDDEDGYAVMQVRAPRPGRTDENGGTDPGPSNFGRAPSRKYPTAQKEYMKTPLAPMPVFAARSNYVGPALLRTRAQGLKRXGSSSSTGSEGSKRPKVDYSVPSGPVTKRPQQNMAPFKVPFKVPLKPTTSTDNVTADPFSAADEDFEPDDIPAPPPVQDITNFEDKDSDIEEVAPFSSPAKLPDDIIQLDVSFSQKIPEHLRKETFTSIRKALHKAVIQRDGVEDIWKKVKMSSSSEIARNKIVSSVAQQLEFSVHSMSSTADGYSIRARATVAAVKMLPNFQVWDDDNAVGDDFEDAREVVGVFRRLCKSSKSHGKSRAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.09
5 0.1
6 0.12
7 0.15
8 0.19
9 0.23
10 0.25
11 0.28
12 0.31
13 0.36
14 0.36
15 0.36
16 0.36
17 0.37
18 0.35
19 0.33
20 0.29
21 0.22
22 0.19
23 0.18
24 0.14
25 0.1
26 0.09
27 0.09
28 0.11
29 0.12
30 0.17
31 0.17
32 0.23
33 0.25
34 0.29
35 0.35
36 0.36
37 0.41
38 0.42
39 0.42
40 0.37
41 0.35
42 0.31
43 0.25
44 0.22
45 0.14
46 0.08
47 0.06
48 0.05
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.04
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.09
62 0.11
63 0.1
64 0.12
65 0.12
66 0.13
67 0.12
68 0.11
69 0.1
70 0.08
71 0.08
72 0.06
73 0.05
74 0.05
75 0.05
76 0.07
77 0.07
78 0.07
79 0.09
80 0.14
81 0.16
82 0.19
83 0.22
84 0.25
85 0.3
86 0.36
87 0.37
88 0.37
89 0.4
90 0.45
91 0.42
92 0.4
93 0.35
94 0.3
95 0.29
96 0.25
97 0.21
98 0.14
99 0.15
100 0.14
101 0.15
102 0.16
103 0.16
104 0.16
105 0.16
106 0.16
107 0.19
108 0.21
109 0.22
110 0.2
111 0.16
112 0.16
113 0.15
114 0.15
115 0.1
116 0.07
117 0.06
118 0.07
119 0.08
120 0.08
121 0.08
122 0.09
123 0.16
124 0.21
125 0.24
126 0.25
127 0.26
128 0.27
129 0.28
130 0.28
131 0.26
132 0.26
133 0.28
134 0.29
135 0.28
136 0.27
137 0.3
138 0.33
139 0.33
140 0.36
141 0.34
142 0.34
143 0.37
144 0.38
145 0.37
146 0.38
147 0.35
148 0.28
149 0.25
150 0.24
151 0.2
152 0.19
153 0.18
154 0.16
155 0.14
156 0.14
157 0.13
158 0.13
159 0.12
160 0.15
161 0.17
162 0.17
163 0.18
164 0.17
165 0.18
166 0.2
167 0.27
168 0.24
169 0.23
170 0.25
171 0.31
172 0.35
173 0.42
174 0.5
175 0.49
176 0.53
177 0.59
178 0.6
179 0.56
180 0.58
181 0.6
182 0.51
183 0.45
184 0.41
185 0.34
186 0.28
187 0.24
188 0.18
189 0.08
190 0.07
191 0.06
192 0.05
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.06
199 0.07
200 0.08
201 0.08
202 0.08
203 0.1
204 0.12
205 0.13
206 0.18
207 0.19
208 0.26
209 0.28
210 0.31
211 0.31
212 0.31
213 0.4
214 0.39
215 0.42
216 0.4
217 0.42
218 0.45
219 0.5
220 0.49
221 0.41
222 0.42
223 0.4
224 0.37
225 0.35
226 0.35
227 0.3
228 0.31
229 0.3
230 0.28
231 0.28
232 0.28
233 0.29
234 0.27
235 0.29
236 0.28
237 0.3
238 0.31
239 0.29
240 0.28
241 0.25
242 0.22
243 0.2
244 0.19
245 0.16
246 0.11
247 0.09
248 0.08
249 0.08
250 0.13
251 0.16
252 0.19
253 0.26
254 0.34
255 0.42
256 0.5
257 0.58
258 0.57
259 0.57
260 0.6
261 0.61
262 0.59
263 0.56
264 0.52
265 0.48
266 0.45
267 0.43
268 0.38
269 0.31
270 0.27
271 0.29
272 0.27
273 0.24
274 0.24
275 0.22
276 0.25
277 0.27
278 0.28
279 0.25
280 0.25
281 0.24
282 0.24
283 0.26
284 0.29
285 0.34
286 0.4
287 0.45
288 0.49
289 0.53
290 0.57
291 0.57
292 0.58
293 0.53
294 0.53
295 0.48
296 0.49
297 0.46
298 0.43
299 0.4
300 0.32
301 0.34
302 0.26
303 0.23
304 0.16
305 0.15
306 0.13
307 0.13
308 0.14
309 0.09
310 0.07
311 0.06
312 0.05
313 0.05
314 0.05
315 0.04
316 0.03
317 0.03
318 0.03
319 0.02
320 0.03
321 0.02
322 0.02
323 0.02
324 0.02
325 0.03
326 0.03
327 0.03
328 0.04
329 0.04
330 0.05
331 0.06
332 0.06
333 0.07
334 0.07
335 0.1
336 0.12
337 0.15
338 0.16
339 0.16
340 0.2
341 0.21
342 0.2
343 0.19
344 0.17
345 0.15
346 0.18
347 0.21
348 0.19
349 0.19
350 0.19
351 0.18
352 0.18
353 0.17
354 0.14
355 0.11
356 0.09
357 0.1
358 0.12
359 0.13
360 0.17
361 0.16
362 0.15
363 0.15
364 0.15
365 0.14
366 0.13
367 0.14
368 0.14
369 0.17
370 0.18
371 0.18
372 0.22
373 0.27
374 0.29
375 0.27
376 0.24
377 0.22
378 0.22
379 0.23
380 0.24
381 0.26
382 0.3
383 0.35
384 0.41
385 0.39
386 0.4
387 0.39
388 0.34
389 0.31
390 0.3
391 0.25
392 0.21
393 0.23
394 0.24
395 0.23
396 0.23
397 0.18
398 0.15
399 0.15
400 0.13
401 0.12
402 0.13
403 0.16
404 0.17
405 0.18
406 0.16
407 0.15
408 0.14
409 0.14
410 0.11
411 0.07
412 0.06
413 0.05
414 0.05
415 0.05
416 0.06
417 0.06
418 0.07
419 0.07
420 0.07
421 0.07
422 0.06
423 0.11
424 0.1
425 0.12
426 0.12
427 0.15
428 0.15
429 0.15
430 0.19
431 0.15
432 0.15
433 0.16
434 0.15
435 0.12
436 0.14
437 0.15
438 0.11
439 0.14
440 0.13
441 0.11
442 0.13
443 0.19
444 0.18
445 0.19
446 0.19
447 0.16
448 0.16
449 0.17
450 0.18
451 0.14
452 0.15
453 0.14
454 0.13
455 0.13
456 0.12
457 0.11
458 0.09
459 0.08
460 0.08
461 0.09
462 0.09
463 0.12
464 0.16
465 0.17
466 0.18
467 0.19
468 0.21
469 0.26
470 0.29
471 0.34
472 0.39
473 0.49
474 0.57
475 0.65
476 0.72
477 0.75
478 0.81
479 0.82
480 0.84
481 0.8
482 0.77
483 0.71
484 0.61
485 0.52
486 0.43
487 0.34
488 0.26
489 0.18
490 0.11
491 0.1
492 0.1
493 0.11
494 0.11
495 0.13
496 0.13
497 0.15
498 0.18
499 0.17
500 0.18
501 0.17
502 0.18
503 0.16
504 0.14
505 0.12
506 0.09
507 0.07
508 0.05
509 0.07
510 0.09
511 0.09
512 0.16
513 0.18
514 0.19
515 0.22
516 0.27
517 0.3
518 0.31
519 0.36
520 0.32
521 0.36
522 0.35
523 0.33
524 0.28
525 0.24
526 0.22
527 0.16
528 0.17
529 0.11
530 0.13
531 0.13
532 0.17
533 0.22
534 0.24
535 0.3
536 0.35
537 0.4
538 0.41
539 0.43
540 0.5
541 0.53
542 0.58
543 0.58
544 0.55
545 0.54
546 0.54
547 0.57
548 0.5
549 0.41
550 0.35
551 0.33
552 0.31
553 0.27
554 0.23
555 0.21
556 0.2
557 0.21
558 0.19
559 0.19
560 0.16
561 0.18
562 0.18
563 0.15
564 0.13
565 0.12
566 0.12
567 0.13
568 0.14
569 0.14
570 0.14
571 0.14
572 0.19
573 0.23
574 0.25
575 0.28
576 0.3
577 0.34
578 0.36
579 0.37
580 0.33
581 0.32
582 0.32
583 0.27
584 0.26
585 0.21
586 0.21
587 0.23
588 0.27
589 0.31
590 0.34
591 0.33
592 0.32
593 0.35
594 0.38
595 0.42
596 0.41
597 0.43
598 0.44
599 0.45
600 0.44
601 0.44
602 0.4
603 0.4
604 0.43
605 0.42
606 0.43
607 0.45
608 0.51
609 0.54
610 0.63
611 0.63
612 0.62
613 0.59
614 0.53
615 0.51
616 0.48
617 0.41
618 0.38
619 0.34
620 0.36
621 0.34
622 0.41
623 0.44
624 0.43
625 0.45
626 0.45
627 0.45
628 0.4
629 0.39
630 0.34
631 0.29
632 0.28
633 0.25
634 0.19
635 0.16
636 0.13
637 0.11
638 0.09
639 0.08
640 0.08
641 0.09
642 0.1
643 0.1
644 0.1
645 0.1
646 0.09
647 0.11
648 0.1
649 0.11
650 0.11
651 0.11
652 0.11
653 0.12
654 0.13
655 0.13
656 0.14
657 0.17
658 0.2
659 0.28
660 0.27
661 0.26
662 0.26
663 0.25
664 0.25
665 0.23
666 0.19
667 0.11
668 0.12
669 0.12
670 0.11
671 0.12
672 0.1
673 0.09
674 0.08
675 0.11
676 0.11
677 0.13
678 0.16
679 0.17
680 0.18
681 0.22
682 0.26
683 0.24
684 0.24
685 0.23
686 0.18
687 0.18
688 0.17
689 0.15
690 0.11
691 0.1
692 0.12
693 0.13
694 0.18
695 0.26
696 0.35
697 0.39
698 0.45
699 0.5
700 0.5
701 0.53
702 0.57
703 0.55
704 0.52
705 0.52
706 0.5
707 0.52
708 0.54
709 0.54
710 0.51
711 0.51
712 0.5
713 0.53
714 0.56
715 0.56
716 0.52
717 0.48
718 0.44
719 0.4
720 0.35
721 0.34
722 0.28
723 0.25
724 0.3
725 0.3
726 0.29
727 0.29
728 0.36
729 0.34
730 0.39
731 0.4
732 0.41
733 0.45
734 0.52
735 0.53
736 0.48
737 0.47
738 0.41
739 0.36
740 0.31
741 0.27
742 0.22
743 0.22
744 0.29
745 0.27
746 0.26
747 0.26
748 0.24
749 0.25
750 0.23
751 0.2
752 0.13
753 0.1
754 0.1
755 0.11
756 0.11
757 0.1
758 0.11
759 0.09
760 0.1
761 0.1
762 0.12
763 0.16
764 0.17
765 0.16
766 0.15
767 0.16
768 0.16
769 0.2
770 0.23
771 0.2
772 0.22
773 0.22
774 0.24
775 0.26
776 0.26
777 0.23
778 0.19
779 0.2
780 0.17
781 0.22
782 0.22
783 0.24
784 0.26
785 0.25
786 0.24
787 0.23
788 0.23
789 0.17
790 0.15
791 0.12
792 0.09
793 0.09
794 0.09
795 0.08
796 0.08
797 0.09
798 0.09
799 0.1
800 0.16
801 0.21
802 0.21
803 0.28
804 0.33
805 0.35
806 0.38
807 0.42
808 0.43
809 0.49
810 0.59
811 0.59
812 0.65