Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Y5V9

Protein Details
Accession A0A4Y9Y5V9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-53TGDERRERRRGDRRGRVPRRVGHBasic
NLS Segment(s)
PositionSequence
35-56RRERRRGDRRGRVPRRVGHRER
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MPAVPFRRLAGPPPANSTQDGNQTGRWEDPTGDERRERRRGDRRGRVPRRVGHRERANVIRIAWFAGRPVPGAHHLAPGPSDGTPPPVGGCKRQYESARVRSTISTRKHPPAPAHLSSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.43
4 0.42
5 0.35
6 0.37
7 0.38
8 0.33
9 0.31
10 0.31
11 0.31
12 0.29
13 0.27
14 0.21
15 0.18
16 0.2
17 0.24
18 0.26
19 0.28
20 0.32
21 0.35
22 0.43
23 0.51
24 0.5
25 0.54
26 0.61
27 0.68
28 0.73
29 0.78
30 0.8
31 0.83
32 0.88
33 0.86
34 0.83
35 0.78
36 0.77
37 0.76
38 0.71
39 0.69
40 0.67
41 0.62
42 0.59
43 0.57
44 0.5
45 0.41
46 0.36
47 0.28
48 0.21
49 0.19
50 0.15
51 0.11
52 0.09
53 0.1
54 0.1
55 0.09
56 0.09
57 0.09
58 0.11
59 0.15
60 0.15
61 0.16
62 0.15
63 0.15
64 0.15
65 0.14
66 0.13
67 0.09
68 0.1
69 0.08
70 0.12
71 0.12
72 0.12
73 0.12
74 0.17
75 0.18
76 0.22
77 0.27
78 0.3
79 0.32
80 0.39
81 0.41
82 0.44
83 0.52
84 0.56
85 0.56
86 0.51
87 0.5
88 0.47
89 0.51
90 0.51
91 0.48
92 0.48
93 0.5
94 0.57
95 0.61
96 0.64
97 0.63
98 0.65
99 0.67