Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Z1E2

Protein Details
Accession A0A4Y9Z1E2    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
300-321LLERAARREKKKRAKAREEAAABasic
453-503AEPKLNTKMRKPTRVHRRRRNAHPCPHYTVPSRGRPSTRLRLRPQRAEPDPHydrophilic
NLS Segment(s)
PositionSequence
304-335AARREKKKRAKAREEAAAEGSGSGRTTREKRR
442-473REKRVRKSINYAEPKLNTKMRKPTRVHRRRRN
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011515  Shugoshin_C  
IPR011516  Shugoshin_N  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0051301  P:cell division  
GO:0045132  P:meiotic chromosome segregation  
Pfam View protein in Pfam  
PF07557  Shugoshin_C  
PF07558  Shugoshin_N  
Amino Acid Sequences MSRRDSRASVTARQNDALFEFENFKKKFLLANRHITKLNSTLSVRIEELNAQISSLYVENLRLRASELALAAQLKKERERSQRVLADTENATHALIKHLGAIRKNHNIPPPPTLKPASPPKHSHSHSHPPRVRRAPSNPDSSSPHAHRLARAPGFPQIHEEDEPDPAPDEDVLSSPSPTPAPRGGKRKAAAPTLSLSPPPSSPPVITTIQVDVDVDEHLLKPSSSGTGSSSSSSSGSRKRISRRQSGLISIGRPASPVRPPSPAFGSPMRREAGLAEEEEEMAAMSGEMEVKEEEEDEILLERAARREKKKRAKAREEAAAEGSGSGRTTREKRRVRESEDEGASSVGVSSIAEGSKLRLKDVTNSNSHGGRRALPPLDTNVSDGERQQTPETDIPSSALTHASTSTRPALSTPATTPAPSHLPTPRASSPVESEALPAGGREKRVRKSINYAEPKLNTKMRKPTRVHRRRRNAHPCPHYTVPSRGRPSTRLRLRPQRAEPDPAPCHSTILTVRGRVCGGRSRARGSRLEDEDDESAGEQADAEFPSGMGMRAGWVNVEGRRRSTQVGSGAGASGSGREVEELRRHSMAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.42
4 0.36
5 0.27
6 0.21
7 0.23
8 0.25
9 0.34
10 0.33
11 0.33
12 0.32
13 0.32
14 0.37
15 0.41
16 0.48
17 0.47
18 0.57
19 0.61
20 0.63
21 0.65
22 0.59
23 0.54
24 0.49
25 0.44
26 0.38
27 0.35
28 0.35
29 0.34
30 0.35
31 0.32
32 0.27
33 0.26
34 0.22
35 0.22
36 0.22
37 0.19
38 0.17
39 0.15
40 0.14
41 0.14
42 0.13
43 0.12
44 0.08
45 0.12
46 0.15
47 0.16
48 0.17
49 0.16
50 0.17
51 0.18
52 0.19
53 0.17
54 0.15
55 0.15
56 0.16
57 0.18
58 0.16
59 0.18
60 0.21
61 0.22
62 0.27
63 0.34
64 0.41
65 0.49
66 0.58
67 0.61
68 0.67
69 0.69
70 0.67
71 0.63
72 0.56
73 0.5
74 0.42
75 0.37
76 0.28
77 0.22
78 0.19
79 0.17
80 0.16
81 0.14
82 0.15
83 0.13
84 0.17
85 0.21
86 0.25
87 0.28
88 0.34
89 0.38
90 0.46
91 0.5
92 0.51
93 0.54
94 0.58
95 0.57
96 0.58
97 0.57
98 0.52
99 0.53
100 0.5
101 0.44
102 0.45
103 0.52
104 0.52
105 0.54
106 0.56
107 0.56
108 0.63
109 0.64
110 0.63
111 0.61
112 0.65
113 0.66
114 0.71
115 0.71
116 0.68
117 0.76
118 0.77
119 0.74
120 0.72
121 0.71
122 0.7
123 0.71
124 0.74
125 0.65
126 0.61
127 0.6
128 0.56
129 0.55
130 0.48
131 0.47
132 0.44
133 0.44
134 0.42
135 0.43
136 0.46
137 0.42
138 0.4
139 0.35
140 0.37
141 0.37
142 0.34
143 0.33
144 0.27
145 0.27
146 0.26
147 0.27
148 0.21
149 0.21
150 0.21
151 0.17
152 0.16
153 0.12
154 0.12
155 0.1
156 0.1
157 0.08
158 0.08
159 0.1
160 0.1
161 0.1
162 0.1
163 0.11
164 0.12
165 0.11
166 0.15
167 0.19
168 0.27
169 0.33
170 0.41
171 0.44
172 0.51
173 0.52
174 0.55
175 0.53
176 0.51
177 0.45
178 0.38
179 0.37
180 0.32
181 0.32
182 0.26
183 0.23
184 0.18
185 0.17
186 0.18
187 0.18
188 0.16
189 0.15
190 0.16
191 0.19
192 0.19
193 0.19
194 0.18
195 0.16
196 0.15
197 0.15
198 0.13
199 0.09
200 0.08
201 0.07
202 0.06
203 0.06
204 0.06
205 0.06
206 0.07
207 0.06
208 0.06
209 0.07
210 0.08
211 0.07
212 0.08
213 0.09
214 0.11
215 0.13
216 0.13
217 0.13
218 0.12
219 0.13
220 0.14
221 0.16
222 0.19
223 0.23
224 0.27
225 0.33
226 0.41
227 0.48
228 0.54
229 0.6
230 0.6
231 0.62
232 0.59
233 0.56
234 0.53
235 0.47
236 0.4
237 0.31
238 0.27
239 0.2
240 0.18
241 0.16
242 0.14
243 0.15
244 0.18
245 0.19
246 0.23
247 0.24
248 0.26
249 0.3
250 0.28
251 0.28
252 0.3
253 0.34
254 0.31
255 0.33
256 0.31
257 0.26
258 0.25
259 0.22
260 0.19
261 0.14
262 0.12
263 0.1
264 0.1
265 0.1
266 0.09
267 0.09
268 0.06
269 0.04
270 0.04
271 0.02
272 0.02
273 0.02
274 0.03
275 0.03
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.05
290 0.08
291 0.13
292 0.19
293 0.25
294 0.35
295 0.46
296 0.56
297 0.66
298 0.73
299 0.79
300 0.83
301 0.84
302 0.8
303 0.78
304 0.69
305 0.6
306 0.51
307 0.4
308 0.3
309 0.22
310 0.17
311 0.09
312 0.07
313 0.06
314 0.05
315 0.09
316 0.15
317 0.23
318 0.34
319 0.41
320 0.46
321 0.56
322 0.63
323 0.66
324 0.68
325 0.66
326 0.63
327 0.57
328 0.52
329 0.42
330 0.34
331 0.27
332 0.19
333 0.13
334 0.05
335 0.04
336 0.03
337 0.03
338 0.04
339 0.04
340 0.05
341 0.05
342 0.07
343 0.11
344 0.11
345 0.12
346 0.14
347 0.14
348 0.21
349 0.29
350 0.33
351 0.32
352 0.35
353 0.37
354 0.37
355 0.37
356 0.34
357 0.27
358 0.25
359 0.24
360 0.26
361 0.25
362 0.23
363 0.24
364 0.24
365 0.25
366 0.22
367 0.21
368 0.18
369 0.18
370 0.17
371 0.17
372 0.16
373 0.15
374 0.17
375 0.16
376 0.16
377 0.19
378 0.21
379 0.23
380 0.2
381 0.19
382 0.18
383 0.18
384 0.17
385 0.13
386 0.11
387 0.09
388 0.09
389 0.1
390 0.11
391 0.1
392 0.13
393 0.15
394 0.15
395 0.15
396 0.15
397 0.17
398 0.17
399 0.19
400 0.18
401 0.19
402 0.2
403 0.2
404 0.2
405 0.19
406 0.21
407 0.2
408 0.22
409 0.21
410 0.24
411 0.25
412 0.31
413 0.31
414 0.29
415 0.29
416 0.28
417 0.27
418 0.28
419 0.27
420 0.21
421 0.19
422 0.17
423 0.17
424 0.14
425 0.11
426 0.11
427 0.12
428 0.16
429 0.22
430 0.29
431 0.34
432 0.43
433 0.48
434 0.48
435 0.56
436 0.62
437 0.66
438 0.67
439 0.66
440 0.64
441 0.62
442 0.62
443 0.58
444 0.56
445 0.5
446 0.49
447 0.55
448 0.58
449 0.65
450 0.66
451 0.7
452 0.75
453 0.81
454 0.85
455 0.85
456 0.87
457 0.87
458 0.93
459 0.94
460 0.92
461 0.92
462 0.9
463 0.86
464 0.82
465 0.77
466 0.72
467 0.65
468 0.64
469 0.62
470 0.62
471 0.62
472 0.59
473 0.59
474 0.59
475 0.63
476 0.64
477 0.67
478 0.67
479 0.71
480 0.76
481 0.81
482 0.84
483 0.84
484 0.83
485 0.78
486 0.76
487 0.69
488 0.68
489 0.63
490 0.55
491 0.51
492 0.41
493 0.38
494 0.3
495 0.32
496 0.24
497 0.28
498 0.29
499 0.29
500 0.3
501 0.3
502 0.31
503 0.28
504 0.29
505 0.31
506 0.34
507 0.39
508 0.42
509 0.47
510 0.52
511 0.56
512 0.59
513 0.57
514 0.59
515 0.55
516 0.56
517 0.5
518 0.48
519 0.44
520 0.38
521 0.32
522 0.23
523 0.19
524 0.13
525 0.11
526 0.07
527 0.07
528 0.08
529 0.08
530 0.09
531 0.08
532 0.08
533 0.1
534 0.1
535 0.1
536 0.08
537 0.08
538 0.08
539 0.09
540 0.1
541 0.08
542 0.1
543 0.13
544 0.18
545 0.26
546 0.27
547 0.31
548 0.35
549 0.38
550 0.4
551 0.4
552 0.42
553 0.4
554 0.41
555 0.37
556 0.34
557 0.31
558 0.27
559 0.23
560 0.17
561 0.12
562 0.09
563 0.08
564 0.07
565 0.08
566 0.11
567 0.17
568 0.25
569 0.28
570 0.32