Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XPD4

Protein Details
Accession A0A4Y9XPD4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-77LTRARSARAGRGRRKRERLMDPFBasic
NLS Segment(s)
PositionSequence
56-72TRARSARAGRGRRKRER
Subcellular Location(s) cysk 10, mito 7, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MGDLWQTDGGHGAGWESTYAVLGTAGNGILVFEFGGAMSDRANVSASGGARKFLLTRARSARAGRGRRKRERLMDPFLPVHRDMMADAADIETSTLVHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.06
31 0.06
32 0.08
33 0.08
34 0.1
35 0.11
36 0.1
37 0.1
38 0.1
39 0.1
40 0.12
41 0.2
42 0.17
43 0.23
44 0.28
45 0.31
46 0.34
47 0.35
48 0.39
49 0.41
50 0.5
51 0.54
52 0.59
53 0.66
54 0.73
55 0.81
56 0.81
57 0.81
58 0.82
59 0.8
60 0.78
61 0.71
62 0.66
63 0.62
64 0.55
65 0.5
66 0.4
67 0.33
68 0.25
69 0.21
70 0.17
71 0.15
72 0.13
73 0.1
74 0.1
75 0.09
76 0.08
77 0.08
78 0.08
79 0.06