Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Y8Z5

Protein Details
Accession A0A4Y9Y8Z5    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-35PTPPTPPRPSPPGRNRPPCSRHSPRPSCSRRCTTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035563  SF3As1_ubi  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd01800  Ubl_SF3a120  
Amino Acid Sequences PTPPTPPRPSPPGRNRPPCSRHSPRPSCSRRCTTRASTRRSLSGTSRRRQGCAPRSARRGRGVGTPPVAGMVRSADEMEGGAGAGGAGDDMPPAKRQRVAKLPGGALYPEQDWISMHPHPIALRVQLPTDETKPEWKLDGSVVTVPELPLNLLVSTLRERILAVTGSTLSASRIRLAYGGKMLTNAQTIAVYNLEDEDLLVMSIRDTKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.85
5 0.81
6 0.8
7 0.79
8 0.79
9 0.79
10 0.82
11 0.78
12 0.83
13 0.85
14 0.85
15 0.84
16 0.83
17 0.8
18 0.76
19 0.77
20 0.75
21 0.76
22 0.76
23 0.75
24 0.73
25 0.69
26 0.69
27 0.63
28 0.57
29 0.55
30 0.56
31 0.57
32 0.55
33 0.6
34 0.57
35 0.56
36 0.58
37 0.6
38 0.59
39 0.6
40 0.63
41 0.63
42 0.7
43 0.74
44 0.74
45 0.68
46 0.62
47 0.53
48 0.53
49 0.49
50 0.45
51 0.4
52 0.35
53 0.29
54 0.28
55 0.26
56 0.18
57 0.13
58 0.09
59 0.07
60 0.08
61 0.08
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.03
78 0.03
79 0.07
80 0.08
81 0.1
82 0.14
83 0.17
84 0.23
85 0.31
86 0.35
87 0.38
88 0.39
89 0.39
90 0.36
91 0.34
92 0.27
93 0.19
94 0.16
95 0.11
96 0.08
97 0.08
98 0.07
99 0.06
100 0.07
101 0.11
102 0.1
103 0.11
104 0.1
105 0.11
106 0.11
107 0.14
108 0.13
109 0.11
110 0.13
111 0.13
112 0.13
113 0.13
114 0.14
115 0.15
116 0.15
117 0.16
118 0.14
119 0.19
120 0.2
121 0.21
122 0.2
123 0.18
124 0.18
125 0.17
126 0.17
127 0.14
128 0.14
129 0.14
130 0.13
131 0.13
132 0.12
133 0.11
134 0.09
135 0.08
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.08
142 0.1
143 0.11
144 0.11
145 0.1
146 0.11
147 0.11
148 0.13
149 0.12
150 0.1
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.09
157 0.11
158 0.11
159 0.12
160 0.12
161 0.13
162 0.15
163 0.16
164 0.17
165 0.19
166 0.19
167 0.17
168 0.18
169 0.19
170 0.19
171 0.19
172 0.16
173 0.13
174 0.12
175 0.12
176 0.13
177 0.12
178 0.11
179 0.09
180 0.1
181 0.09
182 0.08
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.06
190 0.13