Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YMQ1

Protein Details
Accession A0A4Y9YMQ1    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSRKSKSRRNSRESVRNRYLARHydrophilic
132-154TDDVRKKRAEKAKRKRERDVDDRBasic
NLS Segment(s)
PositionSequence
136-150VRKKRAEKAKRKRER
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSRKSKSRRNSRESVRNRYLARSRSQPDVTVQDAPPSEPPADSGTITSDVAPSFPTGMYTMHDAAYFPSLPGPSFLPYEDPLFTASSPETLSEGTIXSSHSEMTGGAASTAHARAQEKAARAALSPMVKHKITDDVRKKRAEKAKRKRERDVDDRVRLNNVLPEDRRATSDPPGLVEIMRKAHDYIVELKSELDEEKRRNSTLQALTDLAQQAEEARQREHIAKMAELQQKLDSLDAPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.81
4 0.74
5 0.73
6 0.71
7 0.66
8 0.63
9 0.61
10 0.57
11 0.58
12 0.58
13 0.51
14 0.48
15 0.47
16 0.44
17 0.4
18 0.37
19 0.33
20 0.32
21 0.31
22 0.28
23 0.26
24 0.23
25 0.18
26 0.19
27 0.18
28 0.19
29 0.17
30 0.16
31 0.15
32 0.16
33 0.17
34 0.15
35 0.13
36 0.11
37 0.11
38 0.11
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.13
47 0.13
48 0.13
49 0.13
50 0.12
51 0.12
52 0.14
53 0.13
54 0.09
55 0.11
56 0.1
57 0.11
58 0.12
59 0.12
60 0.11
61 0.12
62 0.12
63 0.13
64 0.14
65 0.16
66 0.15
67 0.14
68 0.13
69 0.13
70 0.13
71 0.12
72 0.1
73 0.09
74 0.09
75 0.09
76 0.08
77 0.07
78 0.08
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.07
90 0.06
91 0.06
92 0.05
93 0.04
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.08
101 0.12
102 0.15
103 0.15
104 0.17
105 0.17
106 0.16
107 0.15
108 0.16
109 0.15
110 0.13
111 0.12
112 0.13
113 0.16
114 0.16
115 0.16
116 0.16
117 0.22
118 0.24
119 0.34
120 0.41
121 0.47
122 0.53
123 0.59
124 0.6
125 0.6
126 0.66
127 0.67
128 0.68
129 0.7
130 0.75
131 0.79
132 0.85
133 0.85
134 0.85
135 0.83
136 0.8
137 0.79
138 0.78
139 0.75
140 0.71
141 0.63
142 0.55
143 0.47
144 0.4
145 0.32
146 0.25
147 0.22
148 0.2
149 0.23
150 0.24
151 0.24
152 0.27
153 0.26
154 0.26
155 0.26
156 0.29
157 0.26
158 0.24
159 0.24
160 0.21
161 0.19
162 0.19
163 0.17
164 0.15
165 0.16
166 0.16
167 0.15
168 0.16
169 0.17
170 0.17
171 0.21
172 0.21
173 0.2
174 0.2
175 0.19
176 0.18
177 0.18
178 0.17
179 0.16
180 0.21
181 0.24
182 0.31
183 0.35
184 0.36
185 0.36
186 0.38
187 0.41
188 0.41
189 0.4
190 0.36
191 0.34
192 0.33
193 0.35
194 0.34
195 0.25
196 0.18
197 0.14
198 0.13
199 0.16
200 0.2
201 0.18
202 0.19
203 0.21
204 0.25
205 0.29
206 0.3
207 0.3
208 0.28
209 0.28
210 0.31
211 0.37
212 0.41
213 0.38
214 0.37
215 0.33
216 0.33
217 0.32
218 0.29