Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Z4D7

Protein Details
Accession A0A4Y9Z4D7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
222-243PEEYKKMSSKEKRQLRNKISARHydrophilic
NLS Segment(s)
PositionSequence
227-258KMSSKEKRQLRNKISARNFRVRRKEHRAAQRD
263-271EGAPRRRGR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MLVDNPLQPSLFTLNNPDMSEFFNIDLMLGSSSQQQAASSSRSSSHSPHSAFSSLPSPPTSFNPNIAINDNQATDFFNFYLEDEYAKVDPLAPPPMATSAAPFDFLGAFAPSGSSPESGNGSADQSPPFSIDPQLVGTPATSKALSDIDEHEEAEMKHEDDHEDDEDDESFLSIAPVKVGGKGKGRRGTVQSGGITKKAAPVVSAVVRVRDDDKDDDWRPSPEEYKKMSSKEKRQLRNKISARNFRVRRKEHRAAQRDLFAQEGAPRRRGRAESPVLPPPGPLPVPAARPASTKPALLTPNMHKDLPTSPRMGNGKAFWGGSAAFGGITPVHTTLIPESFAQPLVGKPVTPRNSSLQENINPSLNGNNTTGLAAAAFGSGPGKAGKPSPAAFDMFADSNPFTMKMLDAYRMQLWTRMAAQQQQQNQHAASQTPAPHKPITGLASNLRPHYFTSASPSKAMLQPSSSNSPLSALLAGKHYPTPPTSPKLTPAAAPKRDSNATNAEHAMIAAMASQTLFQRLGSAFWDAFSGSSPAAATASGSGSPRTQWDADKVRRVLEGKAVVRVVDIEEPRAPAAAPPSIRKMQSTPQMQTPRDKHCDCFTKTLEESMRALSLGKKQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.31
4 0.29
5 0.26
6 0.27
7 0.29
8 0.24
9 0.2
10 0.17
11 0.16
12 0.15
13 0.14
14 0.12
15 0.1
16 0.09
17 0.09
18 0.11
19 0.13
20 0.13
21 0.13
22 0.13
23 0.14
24 0.18
25 0.21
26 0.19
27 0.2
28 0.22
29 0.25
30 0.28
31 0.29
32 0.34
33 0.38
34 0.38
35 0.39
36 0.41
37 0.39
38 0.36
39 0.34
40 0.31
41 0.24
42 0.25
43 0.25
44 0.22
45 0.23
46 0.27
47 0.32
48 0.29
49 0.32
50 0.34
51 0.35
52 0.35
53 0.37
54 0.34
55 0.3
56 0.3
57 0.27
58 0.22
59 0.19
60 0.19
61 0.17
62 0.17
63 0.14
64 0.13
65 0.12
66 0.13
67 0.15
68 0.13
69 0.13
70 0.11
71 0.14
72 0.14
73 0.14
74 0.13
75 0.12
76 0.14
77 0.17
78 0.2
79 0.17
80 0.17
81 0.18
82 0.2
83 0.2
84 0.17
85 0.16
86 0.16
87 0.16
88 0.17
89 0.16
90 0.15
91 0.13
92 0.13
93 0.12
94 0.09
95 0.09
96 0.07
97 0.08
98 0.07
99 0.09
100 0.1
101 0.09
102 0.09
103 0.1
104 0.13
105 0.13
106 0.14
107 0.13
108 0.15
109 0.16
110 0.18
111 0.17
112 0.15
113 0.15
114 0.16
115 0.16
116 0.15
117 0.14
118 0.13
119 0.14
120 0.15
121 0.15
122 0.13
123 0.12
124 0.11
125 0.12
126 0.12
127 0.12
128 0.1
129 0.1
130 0.11
131 0.12
132 0.13
133 0.13
134 0.15
135 0.18
136 0.19
137 0.19
138 0.17
139 0.18
140 0.17
141 0.18
142 0.17
143 0.13
144 0.13
145 0.14
146 0.15
147 0.14
148 0.17
149 0.14
150 0.14
151 0.14
152 0.14
153 0.13
154 0.13
155 0.11
156 0.08
157 0.07
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.07
164 0.08
165 0.12
166 0.15
167 0.19
168 0.26
169 0.32
170 0.4
171 0.45
172 0.46
173 0.47
174 0.49
175 0.5
176 0.45
177 0.45
178 0.39
179 0.38
180 0.37
181 0.33
182 0.29
183 0.23
184 0.23
185 0.2
186 0.17
187 0.13
188 0.13
189 0.15
190 0.16
191 0.2
192 0.17
193 0.17
194 0.17
195 0.18
196 0.19
197 0.17
198 0.19
199 0.17
200 0.19
201 0.25
202 0.26
203 0.29
204 0.28
205 0.28
206 0.27
207 0.27
208 0.31
209 0.29
210 0.34
211 0.35
212 0.4
213 0.43
214 0.45
215 0.53
216 0.56
217 0.6
218 0.63
219 0.69
220 0.72
221 0.77
222 0.83
223 0.79
224 0.81
225 0.77
226 0.77
227 0.77
228 0.76
229 0.73
230 0.73
231 0.74
232 0.72
233 0.76
234 0.73
235 0.74
236 0.75
237 0.77
238 0.75
239 0.78
240 0.77
241 0.73
242 0.69
243 0.63
244 0.55
245 0.47
246 0.39
247 0.28
248 0.21
249 0.2
250 0.25
251 0.23
252 0.27
253 0.27
254 0.27
255 0.31
256 0.33
257 0.32
258 0.33
259 0.37
260 0.36
261 0.4
262 0.44
263 0.41
264 0.39
265 0.36
266 0.27
267 0.24
268 0.18
269 0.15
270 0.13
271 0.14
272 0.16
273 0.19
274 0.21
275 0.19
276 0.2
277 0.21
278 0.23
279 0.22
280 0.21
281 0.18
282 0.21
283 0.21
284 0.2
285 0.23
286 0.21
287 0.28
288 0.3
289 0.29
290 0.24
291 0.25
292 0.29
293 0.29
294 0.27
295 0.22
296 0.2
297 0.26
298 0.27
299 0.27
300 0.24
301 0.2
302 0.2
303 0.18
304 0.18
305 0.12
306 0.12
307 0.1
308 0.08
309 0.08
310 0.06
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.05
319 0.05
320 0.06
321 0.06
322 0.07
323 0.08
324 0.08
325 0.09
326 0.09
327 0.09
328 0.09
329 0.08
330 0.08
331 0.11
332 0.1
333 0.1
334 0.11
335 0.19
336 0.23
337 0.24
338 0.27
339 0.27
340 0.32
341 0.33
342 0.35
343 0.32
344 0.31
345 0.34
346 0.32
347 0.29
348 0.25
349 0.23
350 0.23
351 0.18
352 0.17
353 0.13
354 0.13
355 0.12
356 0.12
357 0.11
358 0.08
359 0.07
360 0.05
361 0.05
362 0.04
363 0.03
364 0.03
365 0.03
366 0.03
367 0.04
368 0.05
369 0.05
370 0.06
371 0.08
372 0.11
373 0.14
374 0.15
375 0.17
376 0.18
377 0.19
378 0.19
379 0.18
380 0.17
381 0.14
382 0.13
383 0.12
384 0.1
385 0.1
386 0.1
387 0.09
388 0.08
389 0.08
390 0.08
391 0.09
392 0.1
393 0.12
394 0.13
395 0.15
396 0.16
397 0.17
398 0.17
399 0.17
400 0.17
401 0.16
402 0.17
403 0.18
404 0.18
405 0.22
406 0.26
407 0.29
408 0.33
409 0.38
410 0.38
411 0.37
412 0.36
413 0.33
414 0.29
415 0.24
416 0.2
417 0.19
418 0.21
419 0.25
420 0.27
421 0.28
422 0.28
423 0.27
424 0.28
425 0.28
426 0.26
427 0.22
428 0.23
429 0.22
430 0.28
431 0.3
432 0.3
433 0.27
434 0.25
435 0.23
436 0.26
437 0.24
438 0.19
439 0.25
440 0.29
441 0.3
442 0.3
443 0.3
444 0.28
445 0.3
446 0.31
447 0.24
448 0.22
449 0.24
450 0.28
451 0.32
452 0.3
453 0.27
454 0.24
455 0.24
456 0.21
457 0.19
458 0.16
459 0.11
460 0.11
461 0.13
462 0.14
463 0.14
464 0.15
465 0.16
466 0.16
467 0.18
468 0.24
469 0.27
470 0.32
471 0.36
472 0.35
473 0.39
474 0.41
475 0.4
476 0.37
477 0.41
478 0.46
479 0.47
480 0.48
481 0.47
482 0.48
483 0.5
484 0.47
485 0.42
486 0.39
487 0.36
488 0.36
489 0.34
490 0.29
491 0.25
492 0.23
493 0.19
494 0.11
495 0.08
496 0.06
497 0.05
498 0.04
499 0.04
500 0.06
501 0.06
502 0.08
503 0.09
504 0.08
505 0.11
506 0.11
507 0.13
508 0.13
509 0.16
510 0.14
511 0.14
512 0.15
513 0.12
514 0.12
515 0.12
516 0.12
517 0.08
518 0.09
519 0.09
520 0.08
521 0.09
522 0.08
523 0.07
524 0.07
525 0.08
526 0.1
527 0.11
528 0.12
529 0.12
530 0.13
531 0.16
532 0.19
533 0.2
534 0.21
535 0.29
536 0.38
537 0.45
538 0.53
539 0.52
540 0.5
541 0.53
542 0.51
543 0.45
544 0.43
545 0.44
546 0.36
547 0.4
548 0.38
549 0.33
550 0.31
551 0.3
552 0.24
553 0.22
554 0.21
555 0.2
556 0.21
557 0.23
558 0.23
559 0.22
560 0.2
561 0.15
562 0.19
563 0.21
564 0.22
565 0.25
566 0.32
567 0.38
568 0.39
569 0.4
570 0.41
571 0.43
572 0.49
573 0.53
574 0.5
575 0.55
576 0.63
577 0.62
578 0.68
579 0.66
580 0.67
581 0.68
582 0.67
583 0.61
584 0.62
585 0.69
586 0.64
587 0.65
588 0.59
589 0.58
590 0.56
591 0.6
592 0.54
593 0.48
594 0.45
595 0.38
596 0.36
597 0.28
598 0.28
599 0.24