Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Y2J1

Protein Details
Accession A0A4Y9Y2J1   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
108-136AITKAKAEKKEKESKKPKPQRTQASATTAHydrophilic
NLS Segment(s)
PositionSequence
60-62KKG
66-77EVAKKRSRKTVK
111-130KAKAEKKEKESKKPKPQRTQ
141-151KQQAKGGRGGR
Subcellular Location(s) nucl 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MKVEIDVFSGYRIYPSKGRLFVRGDSKIFRFGASKNQSLFLQRKNPRKIAWTQVYRRMHKKGVTEEVAKKRSRKTVKHQRGIVGADLAAIAAKRNQTSQVRTQQRLAAITKAKAEKKEKESKKPKPQRTQASATTARNISKQQAKGGRGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.32
4 0.38
5 0.41
6 0.43
7 0.46
8 0.48
9 0.52
10 0.52
11 0.48
12 0.46
13 0.45
14 0.44
15 0.4
16 0.36
17 0.29
18 0.25
19 0.33
20 0.34
21 0.36
22 0.32
23 0.33
24 0.33
25 0.37
26 0.4
27 0.36
28 0.41
29 0.44
30 0.53
31 0.57
32 0.61
33 0.58
34 0.58
35 0.57
36 0.57
37 0.59
38 0.58
39 0.56
40 0.61
41 0.66
42 0.66
43 0.67
44 0.62
45 0.57
46 0.52
47 0.52
48 0.48
49 0.47
50 0.46
51 0.45
52 0.48
53 0.51
54 0.53
55 0.5
56 0.48
57 0.45
58 0.5
59 0.53
60 0.52
61 0.55
62 0.61
63 0.69
64 0.74
65 0.73
66 0.67
67 0.62
68 0.56
69 0.46
70 0.34
71 0.24
72 0.16
73 0.12
74 0.09
75 0.06
76 0.04
77 0.04
78 0.05
79 0.06
80 0.07
81 0.08
82 0.14
83 0.18
84 0.23
85 0.31
86 0.39
87 0.46
88 0.48
89 0.5
90 0.47
91 0.45
92 0.44
93 0.37
94 0.34
95 0.3
96 0.29
97 0.32
98 0.35
99 0.36
100 0.4
101 0.46
102 0.48
103 0.53
104 0.63
105 0.66
106 0.71
107 0.78
108 0.82
109 0.86
110 0.88
111 0.9
112 0.91
113 0.92
114 0.92
115 0.89
116 0.86
117 0.8
118 0.78
119 0.75
120 0.66
121 0.62
122 0.54
123 0.48
124 0.44
125 0.41
126 0.4
127 0.41
128 0.42
129 0.45
130 0.5
131 0.5