Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZB35

Protein Details
Accession A0A4Y9ZB35    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRKPAPSRKKDPLDTTFBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPAPSRKK
Subcellular Location(s) mito 14, nucl 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPAPSRKKDPLDTTFTCLFCHHDSSVSVKVDRKEGIAQLVCKICDQRYQSKVNHLTEPIDIYSEWIDAADAAEKERSVQRRPAAASSSRPRPAAPPSIPSDDEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.91
4 0.87
5 0.84
6 0.79
7 0.76
8 0.68
9 0.64
10 0.59
11 0.5
12 0.43
13 0.36
14 0.33
15 0.27
16 0.28
17 0.22
18 0.19
19 0.2
20 0.23
21 0.28
22 0.26
23 0.26
24 0.26
25 0.26
26 0.28
27 0.27
28 0.24
29 0.21
30 0.2
31 0.23
32 0.21
33 0.21
34 0.21
35 0.22
36 0.2
37 0.19
38 0.19
39 0.15
40 0.18
41 0.22
42 0.26
43 0.29
44 0.35
45 0.35
46 0.43
47 0.48
48 0.45
49 0.43
50 0.36
51 0.33
52 0.28
53 0.28
54 0.19
55 0.14
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.06
62 0.06
63 0.05
64 0.05
65 0.07
66 0.06
67 0.07
68 0.08
69 0.08
70 0.1
71 0.15
72 0.2
73 0.21
74 0.28
75 0.31
76 0.37
77 0.4
78 0.42
79 0.42
80 0.42
81 0.47
82 0.48
83 0.52
84 0.5
85 0.48
86 0.45
87 0.45
88 0.47
89 0.48
90 0.43
91 0.41
92 0.43
93 0.48
94 0.48
95 0.46