Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZGE6

Protein Details
Accession A0A4Y9ZGE6    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-42SDPAPPPPLPKKKSKKRKRDAAAAAVAHydrophilic
NLS Segment(s)
PositionSequence
20-35PPPPLPKKKSKKRKRD
88-91RRRR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPPHSEIDDIFAAKHSDPAPPPPLPKKKSKKRKRDAAAAAVAPAAAPPPAAPDALCTVARHLDRSSSDQEAETREADFQENEASQGRRRRRGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.18
4 0.2
5 0.25
6 0.29
7 0.3
8 0.36
9 0.42
10 0.51
11 0.51
12 0.6
13 0.65
14 0.71
15 0.79
16 0.84
17 0.85
18 0.86
19 0.92
20 0.89
21 0.89
22 0.85
23 0.8
24 0.74
25 0.63
26 0.52
27 0.41
28 0.33
29 0.22
30 0.15
31 0.08
32 0.03
33 0.03
34 0.02
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.09
41 0.11
42 0.12
43 0.1
44 0.11
45 0.16
46 0.16
47 0.17
48 0.15
49 0.17
50 0.18
51 0.23
52 0.26
53 0.23
54 0.24
55 0.23
56 0.24
57 0.24
58 0.24
59 0.2
60 0.17
61 0.15
62 0.15
63 0.16
64 0.15
65 0.13
66 0.14
67 0.14
68 0.15
69 0.18
70 0.2
71 0.24
72 0.33
73 0.41
74 0.46