Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZEP3

Protein Details
Accession A0A4Y9ZEP3   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
127-148PIKCDKCAKRYCPAHRFPNTHAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MSGQSGSNTPSRDDQLLAIGQQCSHPSCLLIDFLPLKCQHCAQPYCAEHFMPLAHSCEKFDETKYNRVAPTCPVCNVPVAIPPGEDPNIRMERHLAEDCSVTTGKPSKGKSAPTCDHAKCNKVLFAPIKCDKCAKRYCPAHRFPNTHACPSLAAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.22
5 0.21
6 0.18
7 0.16
8 0.17
9 0.18
10 0.16
11 0.17
12 0.16
13 0.14
14 0.14
15 0.15
16 0.15
17 0.13
18 0.15
19 0.16
20 0.16
21 0.2
22 0.21
23 0.22
24 0.22
25 0.23
26 0.25
27 0.3
28 0.32
29 0.31
30 0.38
31 0.38
32 0.42
33 0.42
34 0.37
35 0.28
36 0.27
37 0.24
38 0.17
39 0.16
40 0.14
41 0.15
42 0.15
43 0.15
44 0.17
45 0.18
46 0.17
47 0.18
48 0.24
49 0.25
50 0.32
51 0.34
52 0.35
53 0.34
54 0.34
55 0.34
56 0.29
57 0.31
58 0.25
59 0.24
60 0.22
61 0.21
62 0.21
63 0.2
64 0.15
65 0.13
66 0.13
67 0.12
68 0.1
69 0.1
70 0.11
71 0.12
72 0.12
73 0.09
74 0.14
75 0.18
76 0.18
77 0.18
78 0.17
79 0.17
80 0.22
81 0.23
82 0.17
83 0.15
84 0.15
85 0.15
86 0.16
87 0.15
88 0.1
89 0.12
90 0.16
91 0.18
92 0.23
93 0.25
94 0.29
95 0.33
96 0.41
97 0.45
98 0.5
99 0.5
100 0.49
101 0.56
102 0.5
103 0.55
104 0.52
105 0.5
106 0.45
107 0.44
108 0.43
109 0.36
110 0.41
111 0.38
112 0.37
113 0.41
114 0.45
115 0.45
116 0.44
117 0.5
118 0.47
119 0.5
120 0.56
121 0.53
122 0.56
123 0.63
124 0.72
125 0.74
126 0.8
127 0.81
128 0.81
129 0.81
130 0.77
131 0.78
132 0.72
133 0.68
134 0.6
135 0.51
136 0.44